DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Eci3

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001009275.1 Gene:Eci3 / 291076 RGDID:1310224 Length:303 Species:Rattus norvegicus


Alignment Length:275 Identity:55/275 - (20%)
Similarity:103/275 - (37%) Gaps:53/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MRSKVLSLVARAGSNRMMSTATKLTTVEVNDKTGIATLTMNRP-PVNGLNLELLQDLKSSIDEIE 65
            :.|...|...:.|:::   .|.:...:.|..:.||.|:|.||| ..|.::.::.:|:..::....
  Rat    29 LSSSETSSQGKGGADK---KAQESKDILVTSEDGITTITFNRPSKKNAISFQMYKDIMLALKNAS 90

  Fly    66 SNKSRGLILTSSSSTIFSAGLDILEMYKPD---KDRIRAFWTQLQDTWLALYGSSVPTAAAINGH 127
            ::.|...:.|.... .:|:|.|:.......   :|::......|::..........|..|.:|| 
  Rat    91 TDNSVITVFTGVGD-YYSSGNDLRNFINDAGEIQDKVTMCAVLLREFVNTFIDFPKPLVAVVNG- 153

  Fly   128 SPAGGCLLATSCEYRVMVPNFTIGLNETQLGIVAPQW------FMASFLSV-----------LPQ 175
             ||                   :|:..|.||:....:      |...|:.:           .|:
  Rat   154 -PA-------------------VGIAVTLLGLFDAVYASDRATFHTPFIHLGQNPEACSSYTFPK 198

  Fly   176 RI----AERALNQGRMFTTEEALKVGLIDETANNKEEAIEKCV-AFIGTFAKVNPLARSLTKQQF 235
            .:    |...|..|:..|..||...||:.|..  .|...|..| ..:.|:||::|....:.|:..
  Rat   199 MMGSAKAAEMLLFGKKLTAREAWAQGLVTEVF--PESTFETEVWTRLKTYAKLSPNGMRVFKELI 261

  Fly   236 RAADLQQLQNGRKED 250
            |..:.|:|.....|:
  Rat   262 RNHERQKLYTVNAEE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 42/215 (20%)
Eci3NP_001009275.1 crotonase-like 46..301 CDD:304874 52/255 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.