DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and HIBCH

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_055177.2 Gene:HIBCH / 26275 HGNCID:4908 Length:386 Species:Homo sapiens


Alignment Length:308 Identity:61/308 - (19%)
Similarity:114/308 - (37%) Gaps:89/308 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ATKLTTVEVNDKTGIATLTMNRPP-VNGLNLELLQDLKSSIDEIESNKSRGL-ILTSSSSTIFSA 84
            |.:...:|....||:  :|:|||. :|.|.|.:::.:...:.:.|.:....| |:..:....|.|
Human    34 AAEEVLLEKKGCTGV--ITLNRPKFLNALTLNMIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCA 96

  Fly    85 GLDILEMYKPDKDRIRAFWTQLQDTWL---ALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVP 146
            |.||..:.:.:|.:.:......::.::   |:.....|..|.|:|.:..||..|:...::||...
Human    97 GGDIRVISEAEKAKQKIAPVFFREEYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATE 161

  Fly   147 NFTIGLNETQLGI--------VAPQ------WFMA------------------------------ 167
            .....:.||.:|:        ..|:      :|:|                              
Human   162 KCLFAMPETAIGLFPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLE 226

  Fly   168 ------------SFLSVLPQRIAERALNQGRMFTTEEALKVGLIDE-----TANNKEEAIEKCVA 215
                        :..|||.....|..:::.:.|..||.:     |:     :||..||.||....
Human   227 EDLLALKSPSKENIASVLENYHTESKIDRDKSFILEEHM-----DKINSCFSANTVEEIIENLQQ 286

  Fly   216 FIGTFA--------KVNPLARSLTKQQFRAADLQQLQNGRKEDLEKFL 255
            ...:||        |::|.:..:|        |:||..|..:.|::.|
Human   287 DGSSFALEQLKVINKMSPTSLKIT--------LRQLMEGSSKTLQEVL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 49/255 (19%)
HIBCHNP_055177.2 PRK05617 34..378 CDD:235533 61/308 (20%)
ECH_2 47..375 CDD:292731 58/295 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.