DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Eci2

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001103801.1 Gene:Eci2 / 23986 MGIID:1346064 Length:391 Species:Mus musculus


Alignment Length:272 Identity:54/272 - (19%)
Similarity:92/272 - (33%) Gaps:94/272 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VNDKTGIATLTMNRP-PVNGLNLELLQDLKSSIDEIESNKSRGLILTSSSSTIFSAGLDILEMYK 93
            |..:.||..:|.||| ..|.::.::.:|:..::....::.:...:.|.:.. .:.:|.|:.....
Mouse   142 VTSEDGITKITFNRPTKKNAISFQMYRDIILALKNASTDNTVMAVFTGTGD-YYCSGNDLTNFTS 205

  Fly    94 PD--------------KDRIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVM 144
            ..              :|.:.:|           .....|..|.:||  ||              
Mouse   206 ATGGIEEAASNGAVLLRDFVNSF-----------IDFPKPLVAVVNG--PA-------------- 243

  Fly   145 VPNFTIGLNETQLGIVAPQWFMASFLS----------------------VLPQRI----AERALN 183
                 :|::.|.||:     |.|.|.|                      ..|:.:    |...|.
Mouse   244 -----VGISVTLLGL-----FDAVFASDRATFHTPFSQLGQSPEACSSYTFPKMMGSAKAAEMLL 298

  Fly   184 QGRMFTTEEALKVGLIDETANNKEEAIEKCV-AFIGTFAKVNPLARSLTKQQFRAADLQQLQNGR 247
            .|:..|..||...||:.|..  .|...|..| ..:.|:||:.|.|..::|:..           |
Mouse   299 FGKKLTAREAWAQGLVTEVF--PESTFETEVWTRLKTYAKLPPNAMRISKELI-----------R 350

  Fly   248 KEDLEKFLFFVN 259
            |.:.|| |:.||
Mouse   351 KNEKEK-LYAVN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 41/228 (18%)
Eci2NP_001103801.1 ACBP 38..113 CDD:279259
Acyl-CoA binding. /evidence=ECO:0000250 64..68
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..136
crotonase-like 139..389 CDD:304874 54/272 (20%)
ECH-like 149..319 35/209 (17%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 196..200 1/3 (33%)
Microbody targeting signal. /evidence=ECO:0000255 389..391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.