DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Hibch

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_666220.1 Gene:Hibch / 227095 MGIID:1923792 Length:385 Species:Mus musculus


Alignment Length:325 Identity:65/325 - (20%)
Similarity:120/325 - (36%) Gaps:86/325 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVARAGSNR---------MMSTATKLTTVEVNDKTGIATLTMNRPP-VNGLNLELLQDLKSSIDE 63
            |::|..|.|         .||..|:...|.:..:.....:|:|||. :|.|:|.:::.:...:..
Mouse     9 LLSRVSSFRRASVILQHLRMSMHTEAAEVLLERRGCGGVITLNRPKFLNALSLNMIRQIYPQLKT 73

  Fly    64 IESNKSRGL-ILTSSSSTIFSAGLDILEMYKPDKDRIRAFWTQLQDTWL---ALYGSSVPTAAAI 124
            .|.:....| |:..:....|.||.||..:.:..|.|........::.::   |:.....|..|.|
Mouse    74 WEQDPDTFLIIIKGAGGKAFCAGGDIKALSEAKKARQNLTQDLFREEYILNNAIASCQKPYVALI 138

  Fly   125 NGHSPAGGCLLATSCEYRVMVPNFTIGLNETQLGI---VAPQWF-------MASFLSVLPQRIAE 179
            :|.:..||..|:...::||........:.||.:|:   |...:|       :..||::...|:..
Mouse   139 DGITMGGGVGLSVHGQFRVATERSLFAMPETGIGLFPDVGGGYFLPRLQGKLGYFLALTGYRLKG 203

  Fly   180 RALNQGRM---FTTEEALKV-----------------GLIDE----------------------- 201
            |.:::..:   |...|.|:|                 |:::.                       
Mouse   204 RDVHRAGIATHFVDSEKLRVLEEELLALKSPSAEDVAGVLESYHAKSKMDQDKSIIFEEHMDKIN 268

  Fly   202 ---TANNKEEAIEKCVAFIGTFA--------KVNPLARSLTKQQFRAADLQQLQNGRKEDLEKFL 255
               :||..|:.||........||        |::|.:..:|        |:||..|..:.|::.|
Mouse   269 SCFSANTVEQIIENLRQDGSPFAIEQMKVINKMSPTSLKIT--------LRQLMEGSSKTLQEVL 325

  Fly   256  255
            Mouse   326  325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 47/250 (19%)
HibchNP_666220.1 PRK05617 33..377 CDD:235533 58/301 (19%)
ECH_2 46..374 CDD:292731 57/288 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.