DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and EHHADH

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001957.2 Gene:EHHADH / 1962 HGNCID:3247 Length:723 Species:Homo sapiens


Alignment Length:185 Identity:52/185 - (28%)
Similarity:85/185 - (45%) Gaps:15/185 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IATLTMNRPPVNGLNLELLQDLKSSIDEIESNKSRGLILTSSSSTIFSAGLDILEMYKPDKDRIR 100
            :|.:.:..||||.::..||:|:|..:.:...:.:...|:...:...||||.||.....|     |
Human    11 LALIRLRNPPVNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEGKFSAGADIRGFSAP-----R 70

  Fly   101 AFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPNFTIGLNETQLGIVAPQWF 165
            .|...|......:..:..|..|||.|.:..||..||..|.||:......:||.|..||::..   
Human    71 TFGLTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQVGLPEVTLGLLPG--- 132

  Fly   166 MASFLSVLPQRIAERA----LNQGRMFTTEEALKVGLIDETANNKEEAIEKCVAF 216
             |....:||:.....|    :..||....:||||:|::|:..|:  :.:|:.:.|
Human   133 -ARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNS--DPVEEAIRF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 52/185 (28%)
EHHADHNP_001957.2 Enoyl-CoA hydratase / isomerase 1..282 52/185 (28%)
fadJ 20..705 CDD:333311 50/176 (28%)
3-hydroxyacyl-CoA dehydrogenase 283..572
Microbody targeting signal 721..723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.