DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and ECHS1

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_004083.3 Gene:ECHS1 / 1892 HGNCID:3151 Length:290 Species:Homo sapiens


Alignment Length:270 Identity:64/270 - (23%)
Similarity:109/270 - (40%) Gaps:34/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VNDKTG----IATLTMNRP-PVNGLNLELLQDLKSSIDEIESNKSRGLILTSSSSTIFSAGLDIL 89
            :.:|.|    :..:.:||| .:|.|...|:.:|..::...|.:.:.|.|:.:.....|:||.||.
Human    37 IAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIK 101

  Fly    90 EMYKPDKDRIRAFWTQLQDT--------WLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVP 146
            ||..          ...||.        |..|.....|..||:||::..|||.||..|:......
Human   102 EMQN----------LSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGE 156

  Fly   147 NFTIGLNETQLGIVAPQWFMASFLSVLPQRIAERALNQGRMFTTEEALKVGLIDETANNK---EE 208
            .......|..:|.:............:.:.:|...:..|...:.::|.:.||:.:....:   ||
Human   157 KAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEE 221

  Fly   209 AIEKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNGRKEDLEKFLFFVN--QPAVQKGLGIYL 271
            ||: |...|.:.:|:   ..::.|:...||....|..|.|  |||.||:..  ....::|:..::
Human   222 AIQ-CAEKIASNSKI---VVAMAKESVNAAFEMTLTEGSK--LEKKLFYSTFATDDRKEGMTAFV 280

  Fly   272 EGLKKKAKKQ 281
            |..|...|.|
Human   281 EKRKANFKDQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 46/202 (23%)
ECHS1NP_004083.3 crotonase-like 32..288 CDD:304874 62/266 (23%)
Substrate binding 98..101 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.