DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and ech-9

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_501875.2 Gene:ech-9 / 184065 WormBaseID:WBGene00001158 Length:434 Species:Caenorhabditis elegans


Alignment Length:145 Identity:25/145 - (17%)
Similarity:46/145 - (31%) Gaps:67/145 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 LPQRIAERALNQGRM-----------FTTEEALKVGLIDETANNKEEAIEKCVAFIGTFAKVNPL 226
            ||.:|.:...|.|.:           |...|.||          ||..:|.           ||:
 Worm   243 LPHQIDKIITNFGFLMGPMTVADMNGFDVMEKLK----------KENGLEP-----------NPI 286

  Fly   227 ARSL--------------------TKQQFRAADLQQL-----QNGRK-------EDLEKFLFFVN 259
            .:.:                    |:::....:::|:     ||.:.       :|:..|:.:  
 Worm   287 EKEMWRLKRYGRKTNKGFYKYDDKTQRKENDTEMEQIIRRVSQNAKSNIQIINDQDVINFMLY-- 349

  Fly   260 QPAVQKGLGIYLEGL 274
             |.|.:|.....||:
 Worm   350 -PTVNEGYRCIEEGV 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 12/54 (22%)
ech-9NP_501875.2 FadB 38..317 CDD:224170 15/94 (16%)
3HCDH_N 41..217 CDD:280833
3HCDH 220..307 CDD:279114 14/84 (17%)
3HCDH 343..>397 CDD:279114 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.