DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and ech-1.1

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_506810.1 Gene:ech-1.1 / 180037 WormBaseID:WBGene00001150 Length:755 Species:Caenorhabditis elegans


Alignment Length:238 Identity:59/238 - (24%)
Similarity:103/238 - (43%) Gaps:37/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TTVEVNDKTGIATLTMNRPPV--NGLNLELLQDLKSSIDEIESNKS-RGLILTSSSSTIFSAGLD 87
            :|..|..:..:|.:.::.|..  |.||..|..::..::|.::|::| :.:::.|.....|.||.|
 Worm    31 STHRVEKQGDVAVMKIDLPNTTENVLNKALFAEMNETLDRLQSDQSVKAIVVMSGKPNSFVAGAD 95

  Fly    88 ILEMYKPDK------DRIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMV- 145
            | :|:|.:|      :.:|....||    |.:..|..|..|||.|....||..:|.:|.||:.| 
 Worm    96 I-QMFKAEKTAAGVSNLLREGQKQL----LTIELSQKPIVAAIMGSCMGGGLEIALACHYRIAVN 155

  Fly   146 -PNFTIGLNETQLGIVAPQWFMASFLSVLP-----QRIAERALNQGRMFTTEEALKVGLIDETAN 204
             ....:||.|..|||:...    .....||     |.:.:..|. |:.....:|:|:|::|....
 Worm   156 DKKTLLGLPEVTLGIMPGD----GGTQRLPKLTTVQNVLDLTLT-GKRIKANKAMKIGIVDRVIQ 215

  Fly   205 NKEEAIEKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNGR 247
            ...:.|  |.:...|...:..:|         ....::|.||:
 Worm   216 PLGDGI--CTSTETTHKYLEEIA---------VQSARELANGK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 54/205 (26%)
ech-1.1NP_506810.1 fa_ox_alpha_mit 20..754 CDD:131494 59/238 (25%)
crotonase-like 34..216 CDD:119339 51/191 (27%)
3HCDH_N 355..533 CDD:280833
3HCDH 535..630 CDD:279114
3HCDH 668..754 CDD:279114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.