DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and ech-8

DIOPT Version :10

Sequence 1:NP_609322.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_501876.2 Gene:ech-8 / 177905 WormBaseID:WBGene00001157 Length:437 Species:Caenorhabditis elegans


Alignment Length:56 Identity:15/56 - (26%)
Similarity:24/56 - (42%) Gaps:3/56 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 TFAKVNPLARSLTKQQFRAADLQQLQNGRKEDLEKFLFFVNQPAVQKGLGIYLEGL 274
            |..|.|.:......::|.:|....:|....:|...||.:   |.|.:||....||:
 Worm   314 THKKENDIEMEQLIRKFSSAASPNIQILNDQDAVNFLLY---PMVNEGLLCIEEGI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_609322.1 crotonase-like 27..217 CDD:119339
ech-8NP_501876.2 FadB 38..310 CDD:440862
3HCDH 346..>392 CDD:395588 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.