DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and ech-4

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001366707.1 Gene:ech-4 / 174665 WormBaseID:WBGene00001153 Length:385 Species:Caenorhabditis elegans


Alignment Length:239 Identity:50/239 - (20%)
Similarity:93/239 - (38%) Gaps:61/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LTMNRP-PVNGLNLELLQDLKSSIDEIESNKSRGLILTSSSSTIFSAGLDILEMYKP----DKDR 98
            :.:||| ..|.|.||:.|.::.:::...::||..:.:.:::.:.:.||.| |..:|.    .|::
 Worm   140 IALNRPKKFNALTLEMYQGIQKALEVSNNDKSTSITVITANGSYYCAGND-LTNFKAAAGGTKEQ 203

  Fly    99 IRAFWTQ----LQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPNFTIGLNETQLG- 158
            |......    ::|...|......|..|.|||  ||                   :|:..|.|| 
 Worm   204 IADMANTAKVIMKDYVNAYINHEKPLIALING--PA-------------------VGIAVTVLGM 247

  Fly   159 ---IVAPQWFMASF------LSVLPQRI-------------AERALNQGRMFTTEEALKVGLIDE 201
               ::|..  .|||      |...|:.:             |...|...:..:.:.|...||::|
 Worm   248 FDYVIATD--KASFHTPFAPLGQSPEGVSSYTFPLIMGSLRASEMLLVCKKISAQTAKDYGLVNE 310

  Fly   202 TANNKE--EAIEKCVAFIGTFAKVNPLARSLTKQQFRAADLQQL 243
            ...:.|  ...:|.|.   .|:::.|....:.|:..|:...::|
 Worm   311 VVPDAEFQSHAQKTVE---AFSQLPPETLRINKKLLRSLHKEKL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 45/211 (21%)
ech-4NP_001366707.1 ACBP 25..109 CDD:238248
crotonase-like 129..326 CDD:119339 44/209 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.