DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and ech-7

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_740932.1 Gene:ech-7 / 173300 WormBaseID:WBGene00001156 Length:256 Species:Caenorhabditis elegans


Alignment Length:261 Identity:68/261 - (26%)
Similarity:116/261 - (44%) Gaps:27/261 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KTG----IATLTMNRP-PVNGLNLELLQDLKSSIDEIESNKSRGLILTSSSSTIFSAGLDILEMY 92
            :||    :|.:|:||| .:|.|..||:.:|..::.::|.::|..:|:.:.|...|:||.||.||.
 Worm     6 RTGAAENVALITLNRPSALNALCRELMLELSENLLKVEKDQSYHVIVLTGSEKAFAAGADIKEMA 70

  Fly    93 KPDKDRIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPNFTIGLNETQL 157
            |.:...:  |.......|..|...:.|..||:||.:..||..||..|:......|...|..|..:
 Worm    71 KLEFADV--FENDYFTNWDTLSHITKPVIAAVNGFALGGGTELALMCDIVYAGENAIFGQPEITI 133

  Fly   158 GIV-----APQWFMASFLSVLPQRIAERALNQGRMFTTEEALKVGLIDETANNKEEAIEKCVAFI 217
            |.:     ..:|  ..::|   :.:|......|.....:||.:.||:.:.. ..::.:.:.|...
 Worm   134 GTIPGLGGTQRW--PRYVS---KSVAMEICLSGDRLGAQEAKEDGLVSKVF-PVQQLVGEAVLLA 192

  Fly   218 GTFAKVNPLARSLTKQQFRAADLQQLQNGRKEDLEKFLF---FVNQPAVQKGLGIYLEGLKKKAK 279
            ...||.:||.....|:...:|....|..|.  ::||.||   |..... ::|:..:.|   |:|.
 Worm   193 DRIAKNSPLIVKTVKRSLNSAYQTSLNQGL--EMEKQLFQSTFATNDR-REGMSAFAE---KRAP 251

  Fly   280 K 280
            |
 Worm   252 K 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 50/193 (26%)
ech-7NP_740932.1 crotonase-like 12..254 CDD:304874 66/255 (26%)
PRK05617 13..253 CDD:235533 66/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.