DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and ech-1.2

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_491789.1 Gene:ech-1.2 / 172310 WormBaseID:WBGene00020347 Length:781 Species:Caenorhabditis elegans


Alignment Length:307 Identity:70/307 - (22%)
Similarity:127/307 - (41%) Gaps:48/307 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RSKVLSLVARAGSNRM----------MSTATKLTTVEVNDKTGIATLTMNRPPV--NGLNLELLQ 55
            :.::||.:....|:.:          .|.....||..|..:..:|.:.::.|..  |.||..|..
 Worm    24 QKEMLSRLVHQSSSTLRTNLSFRLFSQSAPAMQTTHRVEKQGDVAVVKIDLPNTKENVLNKALFA 88

  Fly    56 DLKSSIDEIESNKS-RGLILTSSSSTIFSAGLDILEMYKPD--KDRIRAFWTQLQDTWLALYGSS 117
            ::|:::|:::|::| :.:::.|.....|.||.|| :|.|.:  .........:.|:.:..:..|.
 Worm    89 EMKATLDKLQSDESIKSIVVMSGKPNSFVAGADI-QMIKAEGTATATETLSREGQEQFFRIEKSQ 152

  Fly   118 VPTAAAINGHSPAGGCLLATSCEYRVMV--PNFTIGLNETQLGIVAPQWFMASFLSVLP-----Q 175
            .|..|||.|....||..||.:|.||:.|  ....:.|.|..||::..    |.....||     |
 Worm   153 KPVVAAIMGSCMGGGLELALACHYRIAVNDKKTLLSLPEVMLGLLPG----AGGTQRLPKLTTVQ 213

  Fly   176 RIAERALNQGRMFTTEEALKVGLIDETANNKEEAIEKCVAFIGTFAKVNPLARSLTK--QQFRAA 238
            .:.:..|. |:....::|.|:|::|.......:.:             .|.|.:..|  ::....
 Worm   214 NVLDLTLT-GKKIKADKAKKIGIVDRVIQPLGDGL-------------GPAAENTHKYLEEIAVK 264

  Fly   239 DLQQLQNGR-KEDLEK-FLFFVNQPAVQKGL---GIYLEGLKKKAKK 280
            ..|:|.||: |.:.:| |:....|..:...|   .:.|:..|.|..|
 Worm   265 AAQELANGKLKINRDKGFMHKATQAVMTNSLFLDNVVLKMAKDKLMK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 49/201 (24%)
ech-1.2NP_491789.1 fa_ox_alpha_mit 46..780 CDD:131494 67/285 (24%)
crotonase-like 60..269 CDD:119339 52/227 (23%)
3HCDH_N 381..559 CDD:280833
3HCDH 561..656 CDD:279114
3HCDH 694..780 CDD:279114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.