DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and C32E8.9

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_491222.2 Gene:C32E8.9 / 171951 WormBaseID:WBGene00016325 Length:268 Species:Caenorhabditis elegans


Alignment Length:258 Identity:60/258 - (23%)
Similarity:113/258 - (43%) Gaps:23/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VEVNDKTGIAT---LTMNRPPVNG-LNLELLQDLKSSIDEIESNKSRGLILTSSSSTIFSAGLDI 88
            |:.|:|  :.|   :.::||..|. |:.|:::.. ....|:.|:....:|:.|.....|.:|.| 
 Worm    26 VQRNEK--LKTRLDVILDRPEKNNCLSGEMMKQF-GEHTELFSDDQNAIIVVSGVGKSFCSGAD- 86

  Fly    89 LEMYKPDKDR---IRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPNFTI 150
            |.:.|...|:   ::.| ..:......|:.|...:.|.|:||:..|...:.:|.:.|:......|
 Worm    87 LGLIKDISDQKLGVQMF-EYMSSILSLLHSSPAISIAKIHGHALGGATEICSSTDIRIAHSGSKI 150

  Fly   151 GLNETQLGIVAPQWFMASFL-SVLPQRIAERALNQGRMFTTEEALKVGLIDETANNKEEAIEKCV 214
            ...::::||| |.|..|.:: .::.:..|..|:.:..:.:.|||...|.:|....:::||..   
 Worm   151 AFFQSKMGIV-PSWGGAEYMEGIMGRGRALAAMGRANVMSAEEAKDQGYVDYVYKSEDEAEN--- 211

  Fly   215 AFIGTFAKVNPLARSLTKQQFRAADLQQLQNGRKEDLEKFLFFVNQPAVQKGLGIYLEGLKKK 277
             ||...|..   ...:|:.|  .|.|..::.|:.|..:......|....:..|...||.:.||
 Worm   212 -FINQVASA---GLKVTRAQ--KAMLNAVKIGKTEQKQVLEAVWNGETHRNALQKQLEAVVKK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 45/196 (23%)
C32E8.9NP_491222.2 crotonase-like 24..207 CDD:119339 43/186 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.