DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Echs1

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_511178.1 Gene:Echs1 / 140547 RGDID:69330 Length:290 Species:Rattus norvegicus


Alignment Length:269 Identity:69/269 - (25%)
Similarity:114/269 - (42%) Gaps:40/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VNDKTG----IATLTMNRP-PVNGLNLELLQDLKSSIDEIESNKSRGLILTSSSSTIFSAGLDIL 89
            :.:|.|    :..:.:||| .:|.|...|:::|..:::..|.:.:.|.|:.:.....|:||.||.
  Rat    37 ITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIK 101

  Fly    90 EMYKPDKDRIRAFWTQLQDT--------WLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVP 146
            ||..      |.|    ||.        |..:.....|..||:||::..|||.||..|:......
  Rat   102 EMQN------RTF----QDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGE 156

  Fly   147 NFTIGLNETQLGIVAPQWFMASFLSVLPQRIAERALNQGRMFTTEEALKVGLID-----ETANNK 206
            ....|..|..||.:............:.:.:|...:..|...:.::|.:.||:.     ||.  .
  Rat   157 KAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETL--V 219

  Fly   207 EEAIEKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNGRKEDLEKFLFFVN--QPAVQKGLGI 269
            ||||: |...|...:|:   ..::.|:...||....|..|.|  |||.||:..  ....::|:..
  Rat   220 EEAIQ-CAEKIANNSKI---IVAMAKESVNAAFEMTLTEGNK--LEKKLFYSTFATDDRREGMSA 278

  Fly   270 YLEGLKKKA 278
            ::|  |:||
  Rat   279 FVE--KRKA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 51/204 (25%)
Echs1NP_511178.1 crotonase-like 32..288 CDD:419961 69/269 (26%)
Substrate binding 98..101 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.