DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Cdyl

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_034011.1 Gene:Cdyl / 12593 MGIID:1339956 Length:593 Species:Mus musculus


Alignment Length:298 Identity:59/298 - (19%)
Similarity:112/298 - (37%) Gaps:69/298 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SNRMMSTATKLTTVEVNDKTGIA--TLTMNRPPVNGLNLELLQDLKSSIDEIESNKSRGLILTSS 77
            |.|...:|.:...:.|..:.|..  .|:......|.||.|::::::|::....::.|: |:|.|:
Mouse   326 SVRQTESAYRYRDIVVRKQDGFTHILLSTKSSENNSLNPEVMKEVQSALSTAAADDSK-LVLLSA 389

  Fly    78 SSTIFSAGLDILEMYKPDKDRIRAFWTQLQDTWLALYGSSV----PTAAAINGHSPAGGCLLATS 138
            ..::|..|||.:...:...|..:...|::.|.......:.:    |...|:||.:...|..:...
Mouse   390 VGSVFCCGLDFIYFIRRLTDDRKRESTKMADAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPL 454

  Fly   139 CEYRVMVPNFTIGLNETQLGIVAPQWFMASFLS-----------VLPQRIAERALNQ----GRMF 188
            |:        .:..||       ..||...:.:           :.|:.:...:.|:    ||..
Mouse   455 CD--------VVWANE-------KAWFQTPYTTFGQSPDGCSTVMFPKIMGGASANEMLFSGRKL 504

  Fly   189 TTEEALKVGLIDETANNKEEAIEKCVAFIGTF-----------AKVNPLARSLTKQQFRA---AD 239
            |.:||...||:.:            |.:.|||           |..||:....:|...|.   .:
Mouse   505 TAQEACGKGLVSQ------------VFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKME 557

  Fly   240 LQQLQNGRKEDLEKFLFFVNQPAVQKGLGIYLEGLKKK 277
            |:|......|.|:|..      ...:|:...|:.|::|
Mouse   558 LEQANERECEVLKKIW------GSAQGMDSMLKYLQRK 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 39/210 (19%)
CdylNP_034011.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
CHROMO 55..109 CDD:214605
Interaction with EZH2. /evidence=ECO:0000250|UniProtKB:Q9Y232 56..304
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..158
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..223
crotonase-like 339..535 CDD:119339 42/223 (19%)
Acetyl-CoA-binding domain. /evidence=ECO:0000255 357..589 52/265 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.