DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Auh

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_057918.2 Gene:Auh / 11992 MGIID:1338011 Length:314 Species:Mus musculus


Alignment Length:275 Identity:73/275 - (26%)
Similarity:116/275 - (42%) Gaps:20/275 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RAGSNRMMSTATKLTTVEVNDKT-GIATLTMNRP-PVNGLNLELLQDLKSSIDEIESNKS-RGLI 73
            |.|.:..:.|..:|....:.::. ||..|.:||. ..|.|:..||:.|..::|.::|:|. |.:|
Mouse    39 RRGYSSEVKTEDELRVRHLEEENRGIVVLGINRAYGKNALSKNLLKMLSKAVDALKSDKKVRTII 103

  Fly    74 LTSSSSTIFSAGLDILEMYKPDKDRIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATS 138
            :.|....||.||.|:.|..|.....:..|.::::.....:....|||.|||:|.:..||..||.:
Mouse   104 IRSEVPGIFCAGADLKERAKMHSSEVGPFVSKIRSVINDIANLPVPTIAAIDGLALGGGLELALA 168

  Fly   139 CEYRVMVPNFTIGLNETQLGIVAPQWFMASFLSVLPQRIAERALNQGRMFTTEEALKVGLIDETA 203
            |:.||...:..:||.||:|.|:............:...:|:..:...|:...:||..||||....
Mouse   169 CDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGQEAKAVGLISHVL 233

  Fly   204 NNKEE---AIEKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNG-------------RKEDLE 252
            ...:|   |..|.:.....|....|:|..:.|..........|..|             .|:.||
Mouse   234 EQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTISTKDRLE 298

  Fly   253 KFLFF-VNQPAVQKG 266
            ..|.| ..:|...||
Mouse   299 GLLAFKEKRPPRYKG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 55/195 (28%)
AuhNP_057918.2 crotonase-like 61..314 CDD:304874 69/253 (27%)
RNA-binding. /evidence=ECO:0000250|UniProtKB:Q13825 80..94 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.