DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and ECI2

DIOPT Version :9

Sequence 1:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_996667.2 Gene:ECI2 / 10455 HGNCID:14601 Length:394 Species:Homo sapiens


Alignment Length:275 Identity:56/275 - (20%)
Similarity:101/275 - (36%) Gaps:76/275 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GSNRMMSTATKLTTVEVNDKTGIATLTMNRP-PVNGLNLELLQDLKSSIDEIESNKSRGLILTSS 77
            |::|   .:|...|:.|..:.||..:..||| ..|.:|.|:..::..::.....:.|...:||.:
Human   131 GTDR---KSTGFETLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSIITVLTGN 192

  Fly    78 SSTIFSAGLDIL-----------EMYKPDKDRIRAFWTQLQDTWLALYGSSV----PTAAAINGH 127
            .. .:|:|.|:.           |..|.:...:|.|           .|..:    |..|.:|| 
Human   193 GD-YYSSGNDLTNFTDIPPGGVEEKAKNNAVLLREF-----------VGCFIDFPKPLIAVVNG- 244

  Fly   128 SPAGGCLLATSCEYRVMVPNFTIGLNETQLGIV--------------------APQWFMA-SFLS 171
             ||                   :|::.|.||:.                    :|:...: :|..
Human   245 -PA-------------------VGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPK 289

  Fly   172 VLPQRIAERALNQGRMFTTEEALKVGLIDETANNKEEAIEKCV-AFIGTFAKVNPLARSLTKQQF 235
            ::....|...|..|:..|..||...||:.|..  .:...:|.| ..:..|||:.|.|..::|:..
Human   290 IMSPAKATEMLIFGKKLTAGEACAQGLVTEVF--PDSTFQKEVWTRLKAFAKLPPNALRISKEVI 352

  Fly   236 RAADLQQLQNGRKED 250
            |..:.::|.....|:
Human   353 RKREREKLHAVNAEE 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 44/227 (19%)
ECI2NP_996667.2 ACBP 40..113 CDD:279259
Acyl-CoA binding. /evidence=ECO:0000250 66..70
crotonase-like 142..335 CDD:119339 43/227 (19%)
ECH-like 151..322 38/205 (19%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 198..202 1/3 (33%)
Microbody targeting signal. /evidence=ECO:0000255 392..394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.