DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5885 and Ssr3

DIOPT Version :9

Sequence 1:NP_001303317.1 Gene:CG5885 / 34314 FlyBaseID:FBgn0025700 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_112382.2 Gene:Ssr3 / 81784 RGDID:621630 Length:185 Species:Rattus norvegicus


Alignment Length:189 Identity:116/189 - (61%)
Similarity:151/189 - (79%) Gaps:10/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GSGKQQKVQSSGFTKEEELLLQDFSRNVSTKSSALFYGNAFIVSAVPIWLFWRIHNMDLWPSSIL 66
            |..|||        .||:|||||||||:|.||||||:||||||||:||||:|||.:|||..|::|
  Rat     5 GGSKQQ--------SEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVL 61

  Fly    67 FVLVTAASTYLMATAYKNIKFQLKHKIAGRREEAVTREVNRQV--GDDKKVTRKEKDERILWKKN 129
            :.::|..||||:|.||||:||.||||:|.:||:||::||.|::  .|::|::|||||||||||||
  Rat    62 YSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKN 126

  Fly   130 EVADYEATTFSIFYNNAIYLAVIIFISFFILKNSTPFINYIFSVGIASGALSLFSTSAQ 188
            ||||||||||||||||.::|.::|..|||||||..|.:|||.|:..:||.::|.||.::
  Rat   127 EVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPTVNYILSISASSGLIALLSTGSK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5885NP_001303317.1 TRAP-gamma 17..186 CDD:284484 111/170 (65%)
Ssr3NP_112382.2 TRAP-gamma 12..183 CDD:399809 111/170 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2294
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5154
Inparanoid 1 1.050 237 1.000 Inparanoid score I3305
OMA 1 1.010 - - QHG55882
OrthoDB 1 1.010 - - D1450535at2759
OrthoFinder 1 1.000 - - FOG0006475
OrthoInspector 1 1.000 - - oto95849
orthoMCL 1 0.900 - - OOG6_107048
Panther 1 1.100 - - LDO PTHR13399
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5447
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.