DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5885 and SSR3

DIOPT Version :9

Sequence 1:NP_001303317.1 Gene:CG5885 / 34314 FlyBaseID:FBgn0025700 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001295126.1 Gene:SSR3 / 6747 HGNCID:11325 Length:198 Species:Homo sapiens


Alignment Length:202 Identity:118/202 - (58%)
Similarity:152/202 - (75%) Gaps:23/202 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GSGKQQKVQSSGFTKEEELLLQDFSRNVSTKSSALFYGNAFIVSAVPIWLFWRIHNMDLWPSSIL 66
            ||.|||        .||:|||||||||:|.||||||:||||||||:||||:|||.:|||..|::|
Human     5 GSSKQQ--------SEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVL 61

  Fly    67 FVLVTAASTYLMATAYKNIKFQLKHKIAGRREEAVTREVNRQV--GDDKKVTRKEKDER------ 123
            :.::|..||||:|.||||:||.||||:|.:||:||::||.|::  .|::|::|||||||      
Human    62 YSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERFDSCLK 126

  Fly   124 -------ILWKKNEVADYEATTFSIFYNNAIYLAVIIFISFFILKNSTPFINYIFSVGIASGALS 181
                   ||||||||||||||||||||||.::|.|:|..|||||||..|.:|||.|:..:||.::
Human   127 YGHHKRGILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIA 191

  Fly   182 LFSTSAQ 188
            |.||.::
Human   192 LLSTGSK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5885NP_001303317.1 TRAP-gamma 17..186 CDD:284484 112/183 (61%)
SSR3NP_001295126.1 TRAP-gamma 12..196 CDD:311185 112/183 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140808
Domainoid 1 1.000 235 1.000 Domainoid score I2367
eggNOG 1 0.900 - - E1_KOG4490
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5154
Inparanoid 1 1.050 238 1.000 Inparanoid score I3368
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55882
OrthoDB 1 1.010 - - D1450535at2759
OrthoFinder 1 1.000 - - FOG0006475
OrthoInspector 1 1.000 - - oto88717
orthoMCL 1 0.900 - - OOG6_107048
Panther 1 1.100 - - LDO PTHR13399
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4190
SonicParanoid 1 1.000 - - X5447
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.