DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5885 and trap-3

DIOPT Version :9

Sequence 1:NP_001303317.1 Gene:CG5885 / 34314 FlyBaseID:FBgn0025700 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_500198.1 Gene:trap-3 / 177028 WormBaseID:WBGene00021420 Length:178 Species:Caenorhabditis elegans


Alignment Length:172 Identity:75/172 - (43%)
Similarity:113/172 - (65%) Gaps:0/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TKEEELLLQDFSRNVSTKSSALFYGNAFIVSAVPIWLFWRIHNMDLWPSSILFVLVTAASTYLMA 79
            ||||||||..:|...|||.:..||.||.|:|..|::||:.:|.|::..|.:::.|....:.||::
 Worm     5 TKEEELLLSSYSATSSTKGNLFFYLNALIISIAPLYLFYGVHQMEIQDSLVVWGLSAVGTAYLLS 69

  Fly    80 TAYKNIKFQLKHKIAGRREEAVTREVNRQVGDDKKVTRKEKDERILWKKNEVADYEATTFSIFYN 144
            .|.||.|..|||:|..:|..||.||::.|...|||:|.|||:||.|::||||||.|:|..|:||.
 Worm    70 LACKNQKCLLKHQIVMKRGSAVEREISGQYAADKKMTVKEKEERALFRKNEVADTESTYLSVFYT 134

  Fly   145 NAIYLAVIIFISFFILKNSTPFINYIFSVGIASGALSLFSTS 186
            |::||.:::..:||:|.|..|..|.:.|...::|.::..||:
 Worm   135 NSLYLTIMLVSAFFLLANVAPVFNLLISTIGSAGLVAFLSTA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5885NP_001303317.1 TRAP-gamma 17..186 CDD:284484 72/168 (43%)
trap-3NP_500198.1 TRAP-gamma 7..176 CDD:284484 72/168 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156138
Domainoid 1 1.000 147 1.000 Domainoid score I2786
eggNOG 1 0.900 - - E1_KOG4490
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5154
Inparanoid 1 1.050 151 1.000 Inparanoid score I2967
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55882
OrthoDB 1 1.010 - - D1450535at2759
OrthoFinder 1 1.000 - - FOG0006475
OrthoInspector 1 1.000 - - oto20241
orthoMCL 1 0.900 - - OOG6_107048
Panther 1 1.100 - - LDO PTHR13399
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4190
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.