DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip2 and AACT1

DIOPT Version :9

Sequence 1:NP_523528.1 Gene:yip2 / 34313 FlyBaseID:FBgn0040064 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_199583.1 Gene:AACT1 / 834823 AraportID:AT5G47720 Length:415 Species:Arabidopsis thaliana


Alignment Length:404 Identity:140/404 - (34%)
Similarity:205/404 - (50%) Gaps:18/404 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAATKGIYIVAAKRTAFGTFGGSLKGINQTQLQTTAAKAALDAAGLKGEQVDTVIVGNVIASSST 66
            |...:.:.:|...||..|.|.|||..:..|:|.:.|.:|||..|.:....|:.|..|||:.::. 
plant     9 SLQPRDVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRAHVDPALVEEVFFGNVLTANL- 72

  Fly    67 DGIYVPRHVGLNCGVPIEKPALGINRLCGSGFQSIVNGAQDILVGGAKIALTGGVENMSQSPFIA 131
             |....|...|..|:|.......||::|.:|.:|::..:|.|.:|...|.:.||:|:||..|...
plant    73 -GQAPARQAALGAGIPYSVICTTINKVCAAGMKSVMLASQSIQLGLNDIVVAGGMESMSNVPKYL 136

  Fly   132 RNVRFGTTLGASYNLEDALWAGLTDTYCKLPMALTAENLADQYKISRERVDEFSLLSQKNWEKGQ 196
            .:.|.|:.||....::..:..||.|.|....|.:..|..||||:|:||..|.:::.|.:.....|
plant   137 PDARRGSRLGHDTVVDGMMKDGLWDVYNDFGMGVCGEICADQYRITREEQDAYAIQSFERGIAAQ 201

  Fly   197 KEGAFNAEITPIKLKVKGKEVDFVVDEHPRPKTTIEGLNKL---------PSLFKKNGVVTAGTA 252
            ....|..||.|:::.........|:|:.       |||.|.         ||..:..|.||||.|
plant   202 NTQLFAWEIVPVEVSTGRGRPSVVIDKD-------EGLGKFDAAKLKKLRPSFKEDGGSVTAGNA 259

  Fly   253 SGICDGASAVIVASEEALKEYNLKPLARLVAFSFVGVKPEIMGIGPVPAIQNVLKVSGKKLEDID 317
            |.|.|||:|:::.|.|...|..|..:|::..::.....||:....|..||...:|.:|.....:|
plant   260 SSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTTPALAIPKAIKRAGLDASQVD 324

  Fly   318 LIEINEAFAAQTLACADALKLDTSKLNVNGGAIALGHPLGASGSRITGHLVHELQRKKLKYGIGS 382
            ..||||||:...||....|.||..:||.:|||::||||||.||:||...|:..|:.||.|||:.|
plant   325 YYEINEAFSVVALANQKLLGLDPERLNAHGGAVSLGHPLGCSGARILVTLLGVLRAKKGKYGVAS 389

  Fly   383 ACIGGGQGIALLLE 396
            .|.|||...||:||
plant   390 ICNGGGGASALVLE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip2NP_523528.1 PRK05790 6..398 CDD:180261 139/400 (35%)
thiolase 9..397 CDD:238383 139/397 (35%)
AACT1NP_199583.1 PLN02644 13..406 CDD:215347 139/400 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.