DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip2 and PKT3

DIOPT Version :9

Sequence 1:NP_523528.1 Gene:yip2 / 34313 FlyBaseID:FBgn0040064 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_180873.1 Gene:PKT3 / 817876 AraportID:AT2G33150 Length:462 Species:Arabidopsis thaliana


Alignment Length:407 Identity:142/407 - (34%)
Similarity:205/407 - (50%) Gaps:39/407 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IYIVAAKRTAF-GTFGGSLKGINQTQLQTTAAKAALDAAGLKGEQVDTVIVGNVIASSSTDGIYV 71
            :.||||.||.. .:..|:.|......|.....:|.::...|...:|..::||.|:|..|......
plant    52 VVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASEC 116

  Fly    72 PRHVGLNCGVPIEKPALGINRLCGSGFQSIVNGAQDILVGGAKIALTGGVENMSQSPFIARNVRF 136
             |......|.|.......:||.|.||.|::.:.|..|..|...|.:..|:|:|:.:|.       
plant   117 -RMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPM------- 173

  Fly   137 GTTLGASYNLEDALWAGLTD---------TYCKLPMALTAENLADQYKISRERVDEFSLLSQKNW 192
                         .|.|..:         ..|.|||.:|:||:|.::.:||:..|:.::.|.:..
plant   174 -------------AWEGSVNPAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKA 225

  Fly   193 EKGQKEGAFNAEITPIKLKV------KGKEVDFVVDEHPRPKTTIEGLNKLPSLFKKNGVVTAGT 251
            ......|.|..||.|:|.|:      ..|.:...||:..||.||:..|.||..:|||:|..|||.
plant   226 AAATAAGKFKDEIIPVKTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGN 290

  Fly   252 ASGICDGASAVIVASEEALKEYNLKPLARLVAFSFVGVKPEIMGIGPVPAIQNVLKVSGKKLEDI 316
            :|.:.|||.||::.......:..|..|.....|:.|||.|.||||||..||...:|.:|.:|:||
plant   291 SSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDI 355

  Fly   317 DLIEINEAFAAQTLACADALKLDTSKLNVNGGAIALGHPLGASGSRITGHLVHELQR--KKLKYG 379
            ||.|||||||:|.:.|.:.|.||..|:||||||:|:||||||:|:|....|:||::|  |..::|
plant   356 DLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFG 420

  Fly   380 IGSACIGGGQGIALLLE 396
            :.|.|||.|.|.|.:.|
plant   421 VVSMCIGTGMGAAAVFE 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip2NP_523528.1 PRK05790 6..398 CDD:180261 142/407 (35%)
thiolase 9..397 CDD:238383 142/406 (35%)
PKT3NP_180873.1 PLN02287 1..456 CDD:215161 142/407 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 126 1.000 Domainoid score I1771
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1088
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.