DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip2 and hadhb

DIOPT Version :9

Sequence 1:NP_523528.1 Gene:yip2 / 34313 FlyBaseID:FBgn0040064 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_989142.1 Gene:hadhb / 394747 XenbaseID:XB-GENE-1009673 Length:470 Species:Xenopus tropicalis


Alignment Length:431 Identity:137/431 - (31%)
Similarity:201/431 - (46%) Gaps:52/431 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KGIYIVAAKRTAFGTFGGSLKGINQTQLQTTAAKAALDAAGLKGEQVDTVIVGNVIASSSTDGIY 70
            |.:.||...||.|...|.:...:....|..||.:..|....:..|.||.::.|.||....|..  
 Frog    48 KNVVIVDGVRTPFLLSGTTYADLMPHDLARTALQGLLQRTNVPREVVDYIVYGTVIQEVKTSN-- 110

  Fly    71 VPRHVGLNCGVPIEKPALGINRLCGSGFQSIVNGAQDILVGGAKIALTGGVENMSQSPF-IARNV 134
            |.|...|..|...:.||..:...|.|..|::..|...|..|...:.:.||||.||..|. .:|.:
 Frog   111 VAREAALGAGFSDKTPAHTVTMACISSNQAMTTGVGLIASGQCDVVVAGGVEFMSDVPIRHSRKM 175

  Fly   135 R-------FGTTLGASYNLEDALWAGLTDTYC--KLP----------MALTAENLADQYKISRER 180
            |       ...|||...    ::.:|:...|.  :||          |..:|:.||..:.:||..
 Frog   176 RKTMLSLNKAKTLGQRL----SVISGIRPNYFAPELPAVAEFSTSETMGHSADRLAAAFSVSRVE 236

  Fly   181 VDEFSLLSQKNWEKGQKEGAFNAEITPIKLKVKGKE-VDFVVDEHPRPKTTIEGLNKL-PSLFKK 243
            .||::|.|....:|.|..|.. :::.|  .||.||: ||  .|...|| :::|.:.|| |:..|.
 Frog   237 QDEYALRSHTLAKKAQDAGLL-SDVIP--YKVPGKQTVD--KDNGIRP-SSMEQMAKLKPAFIKP 295

  Fly   244 NGVVTAGTASGICDGASAVIVASEEALKEYNLKPLARLVAFSFVGVKP-EIMGIGPVPAIQNVLK 307
            :|.|||..:|.:.||||||::.|||.......||.|.|..|.:|...| :.:.:||..|...||:
 Frog   296 HGSVTAANSSFLTDGASAVLIMSEEKALAMGYKPKAYLRDFVYVSQDPKDQLLLGPTYATPKVLE 360

  Fly   308 VSGKKLEDIDLIEINEAFAAQTLACADALKLD-----------------TSKLNVNGGAIALGHP 355
            .:|..|.|||..|.:||||.|.|:...|:..|                 ..|.|:.||:::||||
 Frog   361 RAGLTLADIDAFEFHEAFAGQILSNLKAMDSDWFAQNYMGRKAKVGAPALDKFNMWGGSLSLGHP 425

  Fly   356 LGASGSRITGHLVHELQRKKLKYGIGSACIGGGQGIALLLE 396
            .||:|.|:.....|.|::...:||:.:||..||||..:::|
 Frog   426 FGATGCRLVMAAAHRLKKDGGQYGLVAACAAGGQGHGMIVE 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip2NP_523528.1 PRK05790 6..398 CDD:180261 137/431 (32%)
thiolase 9..397 CDD:238383 136/428 (32%)
hadhbNP_989142.1 thiolase 51..466 CDD:238383 135/426 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.