DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip2 and acat2

DIOPT Version :9

Sequence 1:NP_523528.1 Gene:yip2 / 34313 FlyBaseID:FBgn0040064 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_988965.1 Gene:acat2 / 394562 XenbaseID:XB-GENE-5929870 Length:398 Species:Xenopus tropicalis


Alignment Length:399 Identity:161/399 - (40%)
Similarity:238/399 - (59%) Gaps:7/399 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAATKGIYIVAAKRTAFGTFGGSLKGINQTQLQTTAAKAALDAAGLKGEQVDTVIVGNVIASSS 65
            ||:..:.:.||:|.||..|:|.|:|..:....|.:|..|..|..|.::.::|..||.|.|:.:.:
 Frog     1 MSSREERVAIVSAARTPIGSFNGALSTLPAHTLGSTVIKEVLKRAAIQPQEVSEVIFGQVLTAGA 65

  Fly    66 TDGIYVPRHVGLNCGVPIEKPALGINRLCGSGFQSIVNGAQDILVGGAKIALTGGVENMSQSPFI 130
              |....|...:..|||...||.....:||||.:::..|||.|..|.|.|.:.||:|:|||:|.:
 Frog    66 --GQNPARQASVAAGVPYSIPAWSCQMICGSGLKAVSLGAQSIKTGEADIVVAGGMESMSQAPHL 128

  Fly   131 ARNVRFGTTLGASYNLEDALWA-GLTDTYCKLPMALTAENLADQYKISRERVDEFSLLSQKNWEK 194
            . ::|.|...| ..:|:|::.. ||.|.:.|..|.:||||:|.|:|::||..|..::.||...|.
 Frog   129 V-HMRAGVKAG-DVSLQDSIMCDGLNDAFYKYHMGITAENVAKQWKVTREEQDLLAVQSQNRTEA 191

  Fly   195 GQKEGAFNAEITPIKLKVKGKEVDFVVDEHPRPKTTIEGLNKLPSLFKK--NGVVTAGTASGICD 257
            .||.|.|:.||.|:.:..:...|:..|||.||..:.:|.::||...|.|  :|.||...||||.|
 Frog   192 AQKAGYFDKEIVPVTVPSRKGPVEVKVDEFPRHGSNVEAMSKLKPYFLKDGSGTVTPANASGIND 256

  Fly   258 GASAVIVASEEALKEYNLKPLARLVAFSFVGVKPEIMGIGPVPAIQNVLKVSGKKLEDIDLIEIN 322
            ||:|||:..|...:...|.|:|.:|:.:.||:.|.|||:||:.||:..::.:|..|:::||.|||
 Frog   257 GAAAVILIKESEARRRGLVPMAHIVSSAQVGLDPSIMGVGPIAAIRKAVEKAGWSLDEVDLFEIN 321

  Fly   323 EAFAAQTLACADALKLDTSKLNVNGGAIALGHPLGASGSRITGHLVHELQRKKLKYGIGSACIGG 387
            ||||||.:|....|.|:..|:|..|||:|||||||.||.||...|::.|:|...|.|:.:.||||
 Frog   322 EAFAAQAVAVVKDLGLNPEKVNCQGGAVALGHPLGMSGCRILVTLLYALERTGGKKGVAALCIGG 386

  Fly   388 GQGIALLLE 396
            |.|||:.:|
 Frog   387 GMGIAMCIE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip2NP_523528.1 PRK05790 6..398 CDD:180261 159/394 (40%)
thiolase 9..397 CDD:238383 159/391 (41%)
acat2NP_988965.1 PRK05790 6..396 CDD:180261 159/394 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 1 1.000 - - FOG0000432
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.