DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip2 and ACAT2

DIOPT Version :9

Sequence 1:NP_523528.1 Gene:yip2 / 34313 FlyBaseID:FBgn0040064 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001290182.1 Gene:ACAT2 / 39 HGNCID:94 Length:426 Species:Homo sapiens


Alignment Length:384 Identity:155/384 - (40%)
Similarity:227/384 - (59%) Gaps:5/384 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RTAFGTFGGSLKGINQTQLQTTAAKAALDAAGLKGEQVDTVIVGNVIASSSTDGIYVPRHVGLNC 79
            :|:..:|.|:|..:....|.:|..|..|..|.:..|.|..||.|:|:|:..  |....|...:..
Human    44 QTSRCSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGC--GQNPVRQASVGA 106

  Fly    80 GVPIEKPALGINRLCGSGFQSIVNGAQDILVGGAKIALTGGVENMSQSPFIARNVRFGTTLGASY 144
            |:|...||.....:||||.:::....|.|.:|.:.|.:.||:||||::|.:| .:|.|..:|...
Human   107 GIPYSVPAWSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGMENMSKAPHLA-YLRTGVKIGEMP 170

  Fly   145 NLEDALWAGLTDTYCKLPMALTAENLADQYKISRERVDEFSLLSQKNWEKGQKEGAFNAEITPIK 209
            ..:..|..||||.:....|.:||||:|.::::|||..|:.::|||...|..||.|.|:.||.|:.
Human   171 LTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVL 235

  Fly   210 LKVKGKEVDFVVDEHPRPKTTIEGLNKLPSLFKKN--GVVTAGTASGICDGASAVIVASEEALKE 272
            :..:...::...||.||..:.||.::||...|..:  |.||...||||.|||:||::..:....:
Human   236 VSTRKGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADK 300

  Fly   273 YNLKPLARLVAFSFVGVKPEIMGIGPVPAIQNVLKVSGKKLEDIDLIEINEAFAAQTLACADALK 337
            ..|.||||:|::|.|||:|.||||||:|||:..:..:|..|||:|:.||||||||.:.|....|.
Human   301 RGLTPLARIVSWSQVGVEPSIMGIGPIPAIKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELG 365

  Fly   338 LDTSKLNVNGGAIALGHPLGASGSRITGHLVHELQRKKLKYGIGSACIGGGQGIALLLE 396
            |:..|:|:.||||||||||||||.||...|:|.|:|.....|:.:.|||||.|||:.::
Human   366 LNPEKVNIEGGAIALGHPLGASGCRILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQ 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip2NP_523528.1 PRK05790 6..398 CDD:180261 155/384 (40%)
thiolase 9..397 CDD:238383 155/384 (40%)
ACAT2NP_001290182.1 thiolase 45..425 CDD:238383 155/383 (40%)
PRK05790 49..425 CDD:180261 154/379 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 1 1.000 - - FOG0000432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.