DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip2 and Acat2l1

DIOPT Version :9

Sequence 1:NP_523528.1 Gene:yip2 / 34313 FlyBaseID:FBgn0040064 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_038955699.1 Gene:Acat2l1 / 365096 RGDID:1562948 Length:397 Species:Rattus norvegicus


Alignment Length:388 Identity:151/388 - (38%)
Similarity:235/388 - (60%) Gaps:5/388 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VAAKRTAFGTFGGSLKGINQTQLQTTAAKAALDAAGLKGEQVDTVIVGNVIASSSTDGIYVPRHV 75
            |:|.|::.|:|.|:|..:....|.||..|..|..|.:..|:|..||.|:|:.:..  |....|..
  Rat    11 VSAARSSIGSFSGALFTVPVHDLGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGC--GQNPTRQA 73

  Fly    76 GLNCGVPIEKPALGINRLCGSGFQSIVNGAQDILVGGAKIALTGGVENMSQSPFIARNVRFGTTL 140
            .:..|:|...||.....:||||.:::...||.|.:|.:.|.:.||:||||::|.:| ::|.|..:
  Rat    74 SVGAGIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGMENMSKAPHLA-HLRSGVKM 137

  Fly   141 GASYNLEDALWAGLTDTYCKLPMALTAENLADQYKISRERVDEFSLLSQKNWEKGQKEGAFNAEI 205
            |.....:..|..||||.:....|.:||||:|.::::|||..|..:::||...|..||.|.|:.||
  Rat   138 GEVPLADSILCDGLTDAFHNYHMGITAENVAKKWQVSREAQDRVAVVSQNRAEHAQKAGHFDKEI 202

  Fly   206 TPIKLKVKGKEVDFVVDEHPRPKTTIEGLNKLPSLFKKN--GVVTAGTASGICDGASAVIVASEE 268
            .|:.:..:....:..:||.||..:.:|.::||...|..:  |.||:..|:|:.|||:||::..:.
  Rat   203 VPVHVSSRKGLAEVKIDEFPRHGSNLEAMSKLKPYFLTDGTGTVTSANATGMNDGAAAVVLMKKT 267

  Fly   269 ALKEYNLKPLARLVAFSFVGVKPEIMGIGPVPAIQNVLKVSGKKLEDIDLIEINEAFAAQTLACA 333
            ..:...|||||::|::|..||:|.:||:||:|||:..:..:|..|.|:|:.|||||:||.::|.|
  Rat   268 EAESRMLKPLAQVVSWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLPDVDVFEINEAYAALSVAIA 332

  Fly   334 DALKLDTSKLNVNGGAIALGHPLGASGSRITGHLVHELQRKKLKYGIGSACIGGGQGIALLLE 396
            ..|.|:..|:|::||||||||||||||.||...|:|.|:|.....|:.:.|||||.|||:.::
  Rat   333 KELGLNPEKVNIDGGAIALGHPLGASGCRILVTLLHTLERVGGTRGVAALCIGGGMGIAMCVQ 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip2NP_523528.1 PRK05790 6..398 CDD:180261 151/388 (39%)
thiolase 9..397 CDD:238383 151/388 (39%)
Acat2l1XP_038955699.1 PRK05790 9..396 CDD:180261 151/388 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 1 1.000 - - FOG0000432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.