DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip2 and hadhb

DIOPT Version :9

Sequence 1:NP_523528.1 Gene:yip2 / 34313 FlyBaseID:FBgn0040064 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_956313.1 Gene:hadhb / 336606 ZFINID:ZDB-GENE-030131-8550 Length:471 Species:Danio rerio


Alignment Length:429 Identity:137/429 - (31%)
Similarity:204/429 - (47%) Gaps:46/429 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KGIYIVAAKRTAFGTFGGSLKGINQTQLQTTAAKAALDAAGLKGEQVDTVIVGNVIASSSTDGIY 70
            |.|.:|...||.|...|.:...:....|...|.:..|...|:..:.||.::.|.||....|..  
Zfish    49 KNIVLVEGVRTPFLLSGTTYSDLMPHDLARAALQGLLKRTGIPKDAVDYIVYGAVIQEVKTSN-- 111

  Fly    71 VPRHVGLNCGVPIEKPALGINRLCGSGFQSIVNGAQDILVGGAKIALTGGVENMSQSPF-IARNV 134
            |.|...|..|...:.||..:...|.|..|::......|..|.....:.||||.||..|. .:|.:
Zfish   112 VAREAALGAGFSDKTPAHTVTMACISSNQAMTTAVGLIAAGQCDAVVAGGVEFMSDVPIRHSRKM 176

  Fly   135 R-------FGTTLGASYNLEDALWAGLTDTYCKLP----------MALTAENLADQYKISRERVD 182
            |       ...||||..:|..::  .|.....:||          |..:|:.||..:.:||...|
Zfish   177 RKTMLSLNKAKTLGARLSLLGSI--RLAHLAPELPAVAELSTAETMGHSADRLAAAFGVSRLEQD 239

  Fly   183 EFSLLSQKNWEKGQKEGAFNAEITPIKLKVKGKEVDFVVDEHPRPKTTIEGLNKL-PSLFKKNGV 246
            ||:|.|....:|.| :|...:::  :..:|.||:: ...|...|| :|:|.:.|| |:..|.:|.
Zfish   240 EFALRSHTLAKKAQ-DGGLLSDV--VGFEVPGKDI-VSKDNGIRP-STMEQMAKLKPAFVKPHGT 299

  Fly   247 VTAGTASGICDGASAVIVASEEALKEYNLKPLARLVAFSFVGVKP-EIMGIGPVPAIQNVLKVSG 310
            |||..:|.:.||||||::.|||.......||.|.|..|.:|...| :.:.:||..|...||:.||
Zfish   300 VTAANSSFLTDGASAVLIMSEEKALAMGYKPKAYLRDFVYVSQDPKDQLLLGPTYATPKVLEKSG 364

  Fly   311 KKLEDIDLIEINEAFAAQTLACADALKLD-----------------TSKLNVNGGAIALGHPLGA 358
            ..::|||:.|.:||||.|.:|...|:..|                 ..|.|..||:::||||.||
Zfish   365 LTMDDIDVFEFHEAFAGQIMANLKAMGSDWFAQTYMGRKTKVGVPPMEKFNTWGGSLSLGHPFGA 429

  Fly   359 SGSRITGHLVHELQRKKLKYGIGSACIGGGQGIALLLEA 397
            :|.|:...:.|.||::..:||:.:||..||||.|:::||
Zfish   430 TGCRLVTTVAHRLQKEGGQYGLVAACAAGGQGHAMVIEA 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip2NP_523528.1 PRK05790 6..398 CDD:180261 137/429 (32%)
thiolase 9..397 CDD:238383 133/424 (31%)
hadhbNP_956313.1 thiolase 52..468 CDD:238383 133/424 (31%)
AcCoA-C-Actrans 54..467 CDD:273881 133/421 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.