DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip2 and Acat2

DIOPT Version :9

Sequence 1:NP_523528.1 Gene:yip2 / 34313 FlyBaseID:FBgn0040064 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001006996.1 Gene:Acat2 / 308100 RGDID:1359366 Length:397 Species:Rattus norvegicus


Alignment Length:398 Identity:158/398 - (39%)
Similarity:240/398 - (60%) Gaps:5/398 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAATKGIYIVAAKRTAFGTFGGSLKGINQTQLQTTAAKAALDAAGLKGEQVDTVIVGNVIASSS 65
            |:|.:..:.|::|.|||.|:|.|:|..:....|.||..|..|..|.:..|:|..||.|:|:.:..
  Rat     1 MNAGSDPVVIISAARTAIGSFNGALSTVPVHNLGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGC 65

  Fly    66 TDGIYVPRHVGLNCGVPIEKPALGINRLCGSGFQSIVNGAQDILVGGAKIALTGGVENMSQSPFI 130
              |....|...:..|:|...||.....:||||.:::...||.|.:|.:.|.:.||:||||::|.:
  Rat    66 --GQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGMENMSKAPHL 128

  Fly   131 ARNVRFGTTLGASYNLEDALWAGLTDTYCKLPMALTAENLADQYKISRERVDEFSLLSQKNWEKG 195
            | ::|.|..:|.....:..|..||||.:....|.:||||:|.::::|||..|:.:::||...|..
  Rat   129 A-HLRSGVKMGEVPLADSILCDGLTDAFHNYHMGITAENVAKKWQVSREAQDKVAVVSQNRAEHA 192

  Fly   196 QKEGAFNAEITPIKLKVKGKEVDFVVDEHPRPKTTIEGLNKLPSLFKKN--GVVTAGTASGICDG 258
            ||.|.|:.||.|:.:..:....:..:||.||..:.:|.::||...|..:  |.||...|||:.||
  Rat   193 QKAGHFDKEIVPVHVSSRKGLTEVKIDEFPRHGSNLEAMSKLKPYFLTDGTGTVTPANASGMNDG 257

  Fly   259 ASAVIVASEEALKEYNLKPLARLVAFSFVGVKPEIMGIGPVPAIQNVLKVSGKKLEDIDLIEINE 323
            |:||::..:...:...|||||::|::|..||:|.:||:||:|||:..:..:|..|||:|:.||||
  Rat   258 AAAVVLMKKTEAESRMLKPLAQVVSWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLEDVDVFEINE 322

  Fly   324 AFAAQTLACADALKLDTSKLNVNGGAIALGHPLGASGSRITGHLVHELQRKKLKYGIGSACIGGG 388
            ||||.:.|.|..|.|...|:|::||||||||||||||.||...|:|.|:|.....|:.:.|||||
  Rat   323 AFAAVSAAIAKELGLSPEKVNIDGGAIALGHPLGASGCRILVTLLHTLERVGGTRGVAALCIGGG 387

  Fly   389 QGIALLLE 396
            .|||:.::
  Rat   388 MGIAMCVQ 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip2NP_523528.1 PRK05790 6..398 CDD:180261 156/393 (40%)
thiolase 9..397 CDD:238383 156/390 (40%)
Acat2NP_001006996.1 PRK05790 8..396 CDD:180261 156/391 (40%)
thiolase 9..396 CDD:238383 156/390 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 1 1.000 - - FOG0000432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.