DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip2 and Acaa1b

DIOPT Version :9

Sequence 1:NP_523528.1 Gene:yip2 / 34313 FlyBaseID:FBgn0040064 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_666342.1 Gene:Acaa1b / 235674 MGIID:3605455 Length:424 Species:Mus musculus


Alignment Length:403 Identity:149/403 - (36%)
Similarity:215/403 - (53%) Gaps:20/403 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAATKGIYIVAAKRTAFGTFG-GSLKGINQTQLQTTAAKAALDAAGLKGEQVDTVIVGNVIASS 64
            :.|:...:.:|..:||..|... |..|.....:|.:....|.|....||.||:..:.||||:...
Mouse    31 LQASASDVVVVHGRRTPIGRASRGCFKDTTPDELLSAVLTAVLQDVKLKPEQLGDISVGNVLQPG 95

  Fly    65 STDGIYVPRHVGLNCGVPIEKPALGINRLCGSGFQSIVNGAQDILVGGAKIALTGGVENMSQSPF 129
            :  |..:.|......|:|...|...:||.|.||.|::.|.|..|..|...|.:..|||:|:.|  
Mouse    96 A--GAIMARIAQFLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLS-- 156

  Fly   130 IARNVRFGTTLGASYNLEDALWAGLTDTYCKLPMALTAENLADQYKISRERVDEFSLLSQKNWEK 194
                     ..|...|:...|........|.:||.:|:||:|:::.:||::.|.|:|.||:....
Mouse   157 ---------QRGNHGNISSRLLENEKARDCLIPMGITSENVAERFGVSRQKQDAFALASQQKAAS 212

  Fly   195 GQKEGAFNAEITPIKLKV---KG--KEVDFVVDEHPRPKTTIEGLNKLPSLFKKNGVVTAGTASG 254
            .|..|.|:|||.|:...|   ||  |.:....||..||.||::||.||...||..|..|||.:|.
Mouse   213 AQSRGCFHAEIVPVTTTVLNDKGDKKTITVSQDEGVRPSTTMQGLAKLKPAFKDGGSTTAGNSSQ 277

  Fly   255 ICDGASAVIVASEEALKEYNLKPLARLVAFSFVGVKPEIMGIGPVPAIQNVLKVSGKKLEDIDLI 319
            :.|||:||::|.....:|..|..|..|.:::.|||.|::|||||..||...|:.:|..:.|||:.
Mouse   278 VSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLTVNDIDIF 342

  Fly   320 EINEAFAAQTLACADALKLDTSKLNVNGGAIALGHPLGASGSRITGHLVHELQRK-KLKYGIGSA 383
            |||||||:|.:.|.:.|.:...|:|..|||||||||||.:|:|....|::||:|: :..||:.|.
Mouse   343 EINEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRAYGVVSM 407

  Fly   384 CIGGGQGIALLLE 396
            |||.|.|.|.:.|
Mouse   408 CIGTGMGAAAVFE 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip2NP_523528.1 PRK05790 6..398 CDD:180261 148/398 (37%)
thiolase 9..397 CDD:238383 148/395 (37%)
Acaa1bNP_666342.1 PLN02287 1..420 CDD:215161 148/401 (37%)
thiolase 39..421 CDD:238383 148/395 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3557
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.