DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip2 and Hadhb

DIOPT Version :9

Sequence 1:NP_523528.1 Gene:yip2 / 34313 FlyBaseID:FBgn0040064 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001276727.1 Gene:Hadhb / 231086 MGIID:2136381 Length:475 Species:Mus musculus


Alignment Length:429 Identity:133/429 - (31%)
Similarity:194/429 - (45%) Gaps:46/429 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KGIYIVAAKRTAFGTFGGSLKGINQTQLQTTAAKAALDAAGLKGEQVDTVIVGNVIASSSTDGIY 70
            |.|.:|...|..|...|.|.|.:....|...|....|....:..:.||.:|.|.||....|..  
Mouse    53 KNIVVVEGVRIPFLLSGTSYKDLMPHDLARAALSGLLHRTNIPKDVVDYIIFGTVIQEVKTSN-- 115

  Fly    71 VPRHVGLNCGVPIEKPALGINRLCGSGFQSIVNGAQDILVGGAKIALTGGVENMSQSPF-IARNV 134
            |.|...|..|...:.||..:...|.|..|::......|..|...:.:.||||.||..|. .:||:
Mouse   116 VAREAALGAGFSDKTPAHTVTMACISSNQAMTTAVGLIASGQCDVVVAGGVELMSDVPIRHSRNM 180

  Fly   135 R-------FGTTLGASYNLEDALWAGLTDTYCKLP----------MALTAENLADQYKISRERVD 182
            |       ...|||...:|...........  :||          |..:|:.||..:.:||...|
Mouse   181 RKMMLDLNKAKTLGQRLSLLSKFRLNFLSP--ELPAVAEFSTNETMGHSADRLAAAFAVSRMEQD 243

  Fly   183 EFSLLSQKNWEKGQKEGAFNAEITPIKLKVKGKEVDFVVDEHPRPKTTIEGLNKL-PSLFKKNGV 246
            |::|.|....:|.|.||.. ::|.|  .||.||:. ...|...|| :::|.:.|| |:..|..|.
Mouse   244 EYALRSHSLAKKAQDEGHL-SDIVP--FKVPGKDT-VTKDNGIRP-SSLEQMAKLKPAFIKPYGT 303

  Fly   247 VTAGTASGICDGASAVIVASEEALKEYNLKPLARLVAFSFVGVKP-EIMGIGPVPAIQNVLKVSG 310
            |||..:|.:.|||||:::.||:.......||.|.|..|.:|...| :.:.:||..|...||:.:|
Mouse   304 VTAANSSFLTDGASAMLIMSEDRALAMGYKPKAYLRDFIYVSQDPKDQLLLGPTYATPKVLEKAG 368

  Fly   311 KKLEDIDLIEINEAFAAQTLACADALKLD-----------------TSKLNVNGGAIALGHPLGA 358
            ..:.|||..|.:|||:.|.||...|:..|                 ..|.|:.||:::||||.||
Mouse   369 LTMNDIDAFEFHEAFSGQILANFKAMDSDWFAQNYMGRKTKVGSPPLEKFNIWGGSLSLGHPFGA 433

  Fly   359 SGSRITGHLVHELQRKKLKYGIGSACIGGGQGIALLLEA 397
            :|.|:.....:.|::...:|.:.:||..||||.|:::||
Mouse   434 TGCRLVMAAANRLRKDGGQYALVAACAAGGQGHAMIVEA 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip2NP_523528.1 PRK05790 6..398 CDD:180261 133/429 (31%)
thiolase 9..397 CDD:238383 129/424 (30%)
HadhbNP_001276727.1 thiolase 56..472 CDD:238383 129/424 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.