DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp54 and SRSF11

DIOPT Version :9

Sequence 1:NP_477347.1 Gene:Srp54 / 34312 FlyBaseID:FBgn0024285 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001381331.1 Gene:SRSF11 / 9295 HGNCID:10782 Length:494 Species:Homo sapiens


Alignment Length:568 Identity:181/568 - (31%)
Similarity:251/568 - (44%) Gaps:160/568 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GGNTPRVIQVTNIAPQATKDQMQTLFGNIGKIEEIRLYP----------TIRDVSCPVQSRICYV 57
            ||....||||||::|.|:.:||:||||.:|||:|:||:|          .:.|...||.||:|:|
Human    28 GGGGTEVIQVTNVSPSASSEQMRTLFGFLGKIDELRLFPPEKLESSKNLLLCDSPLPVSSRVCFV 92

  Fly    58 KYTDTTSVPVAQHLTNTVFIDRALIVIPVL--AIPEEYRALEMLKNGTIVPGLQKPDSKLP-PEV 119
            |:.|..|..||||||||||:||||||:|..  .||:|.:||.:|.....|.||......|| |..
Human    93 KFHDPDSAVVAQHLTNTVFVDRALIVVPYAEGVIPDEAKALSLLAPANAVAGLLPGGGLLPTPNP 157

  Fly   120 INRIEGQLPQQVI--KTYDPKLVEFNLPEYPALPSFYDARKIEEIRRTIIVCDVKNEWRLDDLME 182
            :.:| |.:|...:  .|.||.|....||..........|.::.::..|:                
Human   158 LTQI-GAVPLAALGAPTLDPALAALGLPGANLNSQSLAADQLLKLMSTV---------------- 205

  Fly   183 CFQRAGEVKYARWAEKDNKTYCMIEFCEQTSIIHALRMQGQEFKGGHLSVYHSTYSITKPEAKSN 247
                            |.|                              :.|....:..|..||:
Human   206 ----------------DPK------------------------------LNHVAAGLVSPSLKSD 224

  Fly   248 EAAQAEIEEAMTIVKEAQSMISAAIDPVIGMLAKDKRRRSRSRSRSRDRRTSRSRSHRSTSRRRS 312
            .::: ||||||..|:||||:|||||:|   ...::|||.||||||||.|||.             
Human   225 TSSK-EIEEAMKRVREAQSLISAAIEP---DKKEEKRRHSRSRSRSRRRRTP------------- 272

  Fly   313 RRSGSRERRSVSRSRRSRSRGKHSSRSRSKRSRSRHRRSSSRSRRSRSRGGKHSRSSRSRGKRSR 377
              |.||.|||.||||| ||..|..||.|||..|.|...|..|.|||||       :|::|.|:..
Human   273 --SSSRHRRSRSRSRR-RSHSKSRSRRRSKSPRRRRSHSRERGRRSRS-------TSKTRDKKKE 327

  Fly   378 SRHRRSTSRSRS-SRSHGTGGGGSGNGKRSRSRERSKKSHRSEKHSSRSPRSRSKRSSPSPPPAT 441
            .:.::   ||:: .:|:.|     ....||.||||.::..||...|.:.|||..::.|.||.|..
Human   328 DKEKK---RSKTPPKSYST-----ARRSRSASRERRRRRSRSGTRSPKKPRSPKRKLSRSPSPRR 384

  Fly   442 GSKSR-----SSRSKDPVIVSAKSSRRRDRSRTPETRKLKSISEDTEVKSSRS------------ 489
            ..|.:     ..||:|.   ..:|:.::.:|:..|..:.:....|.:||.:|.            
Human   385 HKKEKKKDKDKERSRDE---RERSTSKKKKSKDKEKDRERKSESDKDVKVTRDYDEEEQGYDSEK 446

  Fly   490 ---------SADSKSRKSVSVEK-----------------SDNMDISN 511
                     ...|...|..||||                 .::||:|:
Human   447 EKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp54NP_477347.1 RRM_SRSF11_SREK1 9..85 CDD:240705 47/85 (55%)
RRM2_SREK1 160..242 CDD:240706 4/81 (5%)
SRSF11NP_001381331.1 RRM 34..118 CDD:214636 45/83 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147823
Domainoid 1 1.000 69 1.000 Domainoid score I9686
eggNOG 1 0.900 - - E1_KOG4676
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4132
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45943
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003613
OrthoInspector 1 1.000 - - oto88668
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR32343
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2488
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.950

Return to query results.
Submit another query.