DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp54 and CID8

DIOPT Version :9

Sequence 1:NP_477347.1 Gene:Srp54 / 34312 FlyBaseID:FBgn0024285 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_175769.1 Gene:CID8 / 841802 AraportID:AT1G53650 Length:314 Species:Arabidopsis thaliana


Alignment Length:219 Identity:45/219 - (20%)
Similarity:71/219 - (32%) Gaps:64/219 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RVIQVTNIAPQATKDQMQTLFGNIGKIEEIRLYPTIRDVSCPVQSRICYVKYTDTTSVPVAQHLT 72
            |.:.|::|....|::.:..||.:.|::.:.|:......|     .|..:|:::|......|..|.
plant   128 RTVYVSDIDQSVTEEGLAGLFSSCGQVVDCRICGDPNSV-----LRFAFVEFSDDQGARSALSLG 187

  Fly    73 NTVFIDRALIVIPVLAIPEEYRALEMLKNGTIVPGLQKPDSKLPPEVINRIEGQLPQQVIKTYDP 137
            .|:.               .|..:.:|.:.|.:                                
plant   188 GTMI---------------GYYPVRVLPSKTAI-------------------------------- 205

  Fly   138 KLVEFNLPEYPA-LPSFYDARKIEEIRRTIIVCDVKNEWRLDDLMECFQRA-GEVKYARWA--EK 198
                  ||..|. ||...|.|  |...|||...:|......||:...||.| |||...|..  :.
plant   206 ------LPVNPTFLPRSEDER--EMCSRTIYCTNVDKNATEDDVNTFFQSACGEVTRLRLLGDQV 262

  Fly   199 DNKTYCMIEFCEQTSIIHALRMQG 222
            .:.....:||....|.:.||...|
plant   263 HSTRIAFVEFAMAESAVAALNCSG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp54NP_477347.1 RRM_SRSF11_SREK1 9..85 CDD:240705 14/75 (19%)
RRM2_SREK1 160..242 CDD:240706 20/66 (30%)
CID8NP_175769.1 PAM2 57..72 CDD:399847
RRM1_CID8_like 126..205 CDD:409892 18/96 (19%)
RRM2_CID8_like 221..302 CDD:409893 20/66 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105433
Panther 1 1.100 - - O PTHR32343
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.