DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp54 and CID11

DIOPT Version :9

Sequence 1:NP_477347.1 Gene:Srp54 / 34312 FlyBaseID:FBgn0024285 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001031131.1 Gene:CID11 / 840173 AraportID:AT1G32790 Length:406 Species:Arabidopsis thaliana


Alignment Length:270 Identity:55/270 - (20%)
Similarity:93/270 - (34%) Gaps:74/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RVIQVTNIAPQATKDQMQTLFGNIGKIEEIRLYPTIRDVSCPVQSRICYVKYTDTTSVPVAQHLT 72
            |.:.|:::..|.|::|:..||.:.|::.:.|:......|     .|..::::||......|.:|:
plant   173 RTVYVSDLDQQVTEEQLAGLFVSCGQVVDCRICGDPNSV-----LRFAFIEFTDEEGAMTALNLS 232

  Fly    73 NTVFIDRALIVIPVLAIPEEYRALEMLKNGTIVPGLQKPDSKLPPEVINRIEGQLPQQVIKTYDP 137
            .|:     |...||..:|                      ||.....:|                
plant   233 GTM-----LGFYPVKVLP----------------------SKTAIAPVN---------------- 254

  Fly   138 KLVEFNLPEYPALPSFYDARKIEEIRRTIIVCDVKNEWRLDDLMECFQR-AGEVKYAR-WAEKDN 200
                   |.:  ||...|.|  |...|||...::..:....|:...|:. .|||...| ..:..:
plant   255 -------PTF--LPRTEDER--EMCARTIYCTNIDKKVTQSDVKIFFESFCGEVYRLRLLGDYQH 308

  Fly   201 KT-YCMIEFCEQTSIIHALRMQGQEFKGGHLSVYHSTYSITKPEAKSNEAAQAEIEEAMTIVKEA 264
            .| ...:||....|.|.||...|...  |.|.:          .:...:|..:||.||...:..|
plant   309 STRIAFVEFVMAESAIAALNCSGVVL--GSLPI----------RSSFKDACSSEITEASNALILA 361

  Fly   265 QSMISAAIDP 274
            ..:.:..:.|
plant   362 LQVFTYLMSP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp54NP_477347.1 RRM_SRSF11_SREK1 9..85 CDD:240705 16/75 (21%)
RRM2_SREK1 160..242 CDD:240706 20/84 (24%)
CID11NP_001031131.1 PAM2 88..105 CDD:284542
RRM1_CID8_like 171..250 CDD:240905 22/108 (20%)
RRM2_CID8_like 266..347 CDD:240906 20/92 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR32343
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.