DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp54 and CID13

DIOPT Version :9

Sequence 1:NP_477347.1 Gene:Srp54 / 34312 FlyBaseID:FBgn0024285 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_197832.1 Gene:CID13 / 832515 AraportID:AT5G24440 Length:320 Species:Arabidopsis thaliana


Alignment Length:270 Identity:48/270 - (17%)
Similarity:87/270 - (32%) Gaps:96/270 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RVIQVTNIAPQATKDQMQTLFGNIGKIEEIRLYPTIRDVSCPVQSRICYVKYTDTTSVPVAQHLT 72
            |.:.|::|..|.|::|:.:||.:.|::.:.|:....:.:     .|..::::||......|...:
plant   137 RTVYVSDIDNQVTEEQLASLFLSCGQVVDCRMCGDYKSI-----LRFAFIEFTDAEGARSALRKS 196

  Fly    73 NTVFIDRALIVIPVLAIPEEYRALEMLKNGTIVPGLQKPDSKLPPEVINRIEGQLPQQVIKTYDP 137
            .|:|                                                |..|.:|..:   
plant   197 GTMF------------------------------------------------GSHPIRVFMS--- 210

  Fly   138 KLVEFNLPEYPALPSFYDARK--IEEIRRTIIVCDVKNEWRLDDLMECFQRAGEVKYARWAEKDN 200
                 .....|..|||....|  :|:..:|:...::..|....:|...|                
plant   211 -----KTAIAPVNPSFLPQSKDELEKCGKTVYCTNIDKEVTKMELENFF---------------- 254

  Fly   201 KTYCMIEFCEQTSIIHALRMQGQEFKGGHLSVYHSTYSITKPEAKSNEAAQAEIEEAMTIVKEAQ 265
            ||.|        ..:|.||:.|        ..||.| .|...|.|..|:|.:.:..:..::.|..
plant   255 KTVC--------GEVHHLRLLG--------DFYHQT-RIAFVEFKLAESAISALNCSGVVLGELP 302

  Fly   266 SMISAAIDPV 275
            ..:|.:..||
plant   303 IRVSPSKTPV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp54NP_477347.1 RRM_SRSF11_SREK1 9..85 CDD:240705 15/75 (20%)
RRM2_SREK1 160..242 CDD:240706 16/81 (20%)
CID13NP_197832.1 PAM2 64..78 CDD:336618
RRM1_CID8_like 135..214 CDD:240905 19/137 (14%)
RRM2_CID8_like 230..311 CDD:240906 22/113 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1342709at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105433
Panther 1 1.100 - - O PTHR32343
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.