DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp54 and CID12

DIOPT Version :9

Sequence 1:NP_477347.1 Gene:Srp54 / 34312 FlyBaseID:FBgn0024285 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_192799.1 Gene:CID12 / 826653 AraportID:AT4G10610 Length:336 Species:Arabidopsis thaliana


Alignment Length:130 Identity:30/130 - (23%)
Similarity:58/130 - (44%) Gaps:15/130 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RVIQVTNIAPQATKDQMQTLFGNIGKIEEIRLYPTIRDVSCPVQSRICYVKYTDTTSVPVAQHLT 72
            |.:.|::|..|.|::|:..||...|::.:.|:......|     .|..::::||......|.:|:
plant   150 RTVYVSDIDQQVTEEQLAGLFIGFGQVVDCRICGDPNSV-----LRFAFIEFTDEVGARTALNLS 209

  Fly    73 NTVFIDRALIVIPVLAIPEEYRALEMLKNGTIVPGLQKPDSKLPPEVI--NRIEGQLPQQVIKTY 135
            .|:     |...||..:|.:.....:  |.|.:|..: .:.::....|  ..|:.:|.|..||.:
plant   210 GTM-----LGFYPVKVMPSKTAIAPV--NPTFLPRTE-DEREMCARTIYCTNIDKKLTQTDIKLF 266

  Fly   136  135
            plant   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp54NP_477347.1 RRM_SRSF11_SREK1 9..85 CDD:240705 17/75 (23%)
RRM2_SREK1 160..242 CDD:240706
CID12NP_192799.1 PAM2 74..88 CDD:399847
RRM1_CID8_like 148..227 CDD:409892 21/86 (24%)
RRM2_CID8_like 243..324 CDD:409893 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR32343
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.