DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp54 and CID10

DIOPT Version :9

Sequence 1:NP_477347.1 Gene:Srp54 / 34312 FlyBaseID:FBgn0024285 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001030833.1 Gene:CID10 / 824101 AraportID:AT3G49390 Length:353 Species:Arabidopsis thaliana


Alignment Length:217 Identity:44/217 - (20%)
Similarity:73/217 - (33%) Gaps:61/217 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RVIQVTNIAPQATKDQMQTLFGNIGKIEEIRLYPTIRDVSCPVQSRICYVKYTDTTSVPVAQHLT 72
            |.:.|::|..|.|::.:..:|.|.|::.:.|:......|     .|..::::|:......|..::
plant   169 RTVYVSDIDQQVTEENLAGVFINCGQVVDCRVCGDPNSV-----LRFAFIEFTNEEGARAALSMS 228

  Fly    73 NTVFIDRALIVIPVLAIPEEYRALEMLKNGTIVPGLQKPDSKLPPEVINRIEGQLPQQVIKTYDP 137
            .||.....|.|:|                           ||.....:|                
plant   229 GTVLGFYPLKVLP---------------------------SKTAIAPVN---------------- 250

  Fly   138 KLVEFNLPEYPALPSFYDARKIEEIRRTIIVCDVKNEWRLDDLMECFQR-AGEVKYARWAEKDNK 201
                   |.:  ||...|.|  |...||:...::.......||...|:. .|||...|..:..::
plant   251 -------PTF--LPRSEDER--EMCVRTVYCTNIDKRITQIDLKGFFEMLCGEVHRLRLGDYHHQ 304

  Fly   202 T-YCMIEFCEQTSIIHALRMQG 222
            | ...:||....|.|.||...|
plant   305 TRIAFVEFAMAESAIAALHCSG 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp54NP_477347.1 RRM_SRSF11_SREK1 9..85 CDD:240705 16/75 (21%)
RRM2_SREK1 160..242 CDD:240706 18/65 (28%)
CID10NP_001030833.1 RRM 68..287 CDD:223796 31/176 (18%)
RRM1_CID8_like 167..246 CDD:409892 20/108 (19%)
RRM2_CID8_like 262..342 CDD:409893 18/65 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR32343
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.