DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp54 and CID10

DIOPT Version :10

Sequence 1:NP_477347.1 Gene:Srp54 / 34312 FlyBaseID:FBgn0024285 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_190508.1 Gene:CID10 / 824101 AraportID:AT3G49390 Length:353 Species:Arabidopsis thaliana


Alignment Length:217 Identity:44/217 - (20%)
Similarity:73/217 - (33%) Gaps:61/217 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RVIQVTNIAPQATKDQMQTLFGNIGKIEEIRLYPTIRDVSCPVQSRICYVKYTDTTSVPVAQHLT 72
            |.:.|::|..|.|::.:..:|.|.|::.:.|:......|     .|..::::|:......|..::
plant   169 RTVYVSDIDQQVTEENLAGVFINCGQVVDCRVCGDPNSV-----LRFAFIEFTNEEGARAALSMS 228

  Fly    73 NTVFIDRALIVIPVLAIPEEYRALEMLKNGTIVPGLQKPDSKLPPEVINRIEGQLPQQVIKTYDP 137
            .||.....|.|:|                           ||.....:|                
plant   229 GTVLGFYPLKVLP---------------------------SKTAIAPVN---------------- 250

  Fly   138 KLVEFNLPEYPALPSFYDARKIEEIRRTIIVCDVKNEWRLDDLMECFQR-AGEVKYARWAEKDNK 201
                   |.:  ||...|.|  |...||:...::.......||...|:. .|||...|..:..::
plant   251 -------PTF--LPRSEDER--EMCVRTVYCTNIDKRITQIDLKGFFEMLCGEVHRLRLGDYHHQ 304

  Fly   202 T-YCMIEFCEQTSIIHALRMQG 222
            | ...:||....|.|.||...|
plant   305 TRIAFVEFAMAESAIAALHCSG 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp54NP_477347.1 RRM_SRSF11_SREK1 9..85 CDD:409704 16/75 (21%)
RRM2_SREK1 160..242 CDD:409705 18/65 (28%)
CID10NP_190508.1 PAM2 94..109 CDD:429316
RRM1_CID8_like 167..246 CDD:409892 20/108 (19%)
RRM2_CID8_like 262..342 CDD:409893 18/65 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.