DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13124 and MIF4GD

DIOPT Version :9

Sequence 1:NP_001162923.1 Gene:CG13124 / 34310 FlyBaseID:FBgn0032156 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_016880377.1 Gene:MIF4GD / 57409 HGNCID:24030 Length:345 Species:Homo sapiens


Alignment Length:302 Identity:60/302 - (19%)
Similarity:102/302 - (33%) Gaps:100/302 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 APEPRGHKVASHNQFGQLNNNYAQPYQANINGVDPYMNGNALQRSKSLSSADALTRGMAGLGLGL 278
            |..|.|.:||              |.......:..::.|.|...:..:.|.....||...:| ..
Human    23 ARRPAGDRVA--------------PLGVPSLALTRHLPGPATSGAVLIPSPVKSYRGWLVMG-EP 72

  Fly   279 GNEVADIGQFTPEIQALIDTALEDPN---------------------------KLNSRC------ 310
            ..|...|..|..|.|.|:.|||:.|:                           .:.|||      
Human    73 SREEYKIQSFDAETQQLLKTALKAPSLECTVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYRD 137

  Fly   311 -----LMELTSQFIKRAVESRRFALPISRLCLNIIAREQKE----TFLEALLNTCRQWYQEREKL 366
                 |.::.:..:..:::...|:....|:|..||..|.|:    .|...|||..:|.||.||:|
Human   138 PGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQL 202

  Fly   367 -LFAIQGMKSPSRVRFTAFMAFLTEMFCQLKRRQLQLRTHHEGTPPPLVLLSLLSKCCGDCVRPP 430
             ..::||        :..::.|:..:|..|:...:          |.:.|::.:..|.....:|.
Human   203 RARSLQG--------WVCYVTFICNIFDYLRVNNM----------PMMALVNPVYDCLFRLAQPD 249

  Fly   431 IRSLSEIE----------------------CLFYVLTCIGQD 450
              |||:.|                      |:..:||.:.:|
Human   250 --SLSKEEEVGGPSPGTSTEGCRMDSPAQPCVSPLLTEVSED 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13124NP_001162923.1 MIF4G 280..494 CDD:280935 48/236 (20%)
MIF4GDXP_016880377.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159019
Domainoid 1 1.000 67 1.000 Domainoid score I9811
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto90110
orthoMCL 1 0.900 - - OOG6_109434
Panther 1 1.100 - - O PTHR23254
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4098
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.