Sequence 1: | NP_001162923.1 | Gene: | CG13124 / 34310 | FlyBaseID: | FBgn0032156 | Length: | 510 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016880377.1 | Gene: | MIF4GD / 57409 | HGNCID: | 24030 | Length: | 345 | Species: | Homo sapiens |
Alignment Length: | 302 | Identity: | 60/302 - (19%) |
---|---|---|---|
Similarity: | 102/302 - (33%) | Gaps: | 100/302 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 214 APEPRGHKVASHNQFGQLNNNYAQPYQANINGVDPYMNGNALQRSKSLSSADALTRGMAGLGLGL 278
Fly 279 GNEVADIGQFTPEIQALIDTALEDPN---------------------------KLNSRC------ 310
Fly 311 -----LMELTSQFIKRAVESRRFALPISRLCLNIIAREQKE----TFLEALLNTCRQWYQEREKL 366
Fly 367 -LFAIQGMKSPSRVRFTAFMAFLTEMFCQLKRRQLQLRTHHEGTPPPLVLLSLLSKCCGDCVRPP 430
Fly 431 IRSLSEIE----------------------CLFYVLTCIGQD 450 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13124 | NP_001162923.1 | MIF4G | 280..494 | CDD:280935 | 48/236 (20%) |
MIF4GD | XP_016880377.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165159019 | |
Domainoid | 1 | 1.000 | 67 | 1.000 | Domainoid score | I9811 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | oto90110 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_109434 | |
Panther | 1 | 1.100 | - | - | O | PTHR23254 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4098 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.870 |