DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13124 and mif4gd

DIOPT Version :9

Sequence 1:NP_001162923.1 Gene:CG13124 / 34310 FlyBaseID:FBgn0032156 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_012827220.2 Gene:mif4gd / 549194 XenbaseID:XB-GENE-5757641 Length:246 Species:Xenopus tropicalis


Alignment Length:146 Identity:34/146 - (23%)
Similarity:66/146 - (45%) Gaps:24/146 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 FTPEIQALIDTALEDPNKLNSRCLMELTSQFIKRAVESRRFALPISRLCLNIIAREQKET----F 348
            |..:.|:|:.|||::|..::   |.:..|..:.:::....|:....|:|..||..|.|:|    |
 Frog    15 FDADTQSLLKTALKEPGSVD---LEKAASVIVDQSLRDATFSREAGRMCYTIIQAESKQTGRTVF 76

  Fly   349 LEALLNTCRQWYQEREKLLFAIQGMKSPSRVRFTAFMAFLTEMFCQLKRRQLQLRTHHEGTPPPL 413
            ...|||..:..|:.|::       .::.|...:..::.|:..:|..|:...:          |.|
 Frog    77 RSTLLNRLQVEYKNRKE-------TRARSLQEWVCYVGFMCNVFDYLRVNNM----------PML 124

  Fly   414 VLLSLLSKCCGDCVRP 429
            .|::.:..|..|.|:|
 Frog   125 ALVNPVYDCLFDLVQP 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13124NP_001162923.1 MIF4G 280..494 CDD:280935 34/146 (23%)
mif4gdXP_012827220.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9177
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto103915
Panther 1 1.100 - - O PTHR23254
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4098
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.