DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13124 and mif4gdb

DIOPT Version :9

Sequence 1:NP_001162923.1 Gene:CG13124 / 34310 FlyBaseID:FBgn0032156 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001013302.1 Gene:mif4gdb / 503596 ZFINID:ZDB-GENE-050227-7 Length:222 Species:Danio rerio


Alignment Length:226 Identity:57/226 - (25%)
Similarity:108/226 - (47%) Gaps:25/226 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 IGQFTPEIQALIDTALEDPNKLNSRCLMELTSQFIKRAVESRRFALPISRLCLNIIAREQKET-- 347
            |..|..|.|.|:.|||:||..::   |.:::|..:.::::.:.|:....|:|..|:..|.|:|  
Zfish    11 IQSFDLETQKLLKTALKDPGSVD---LEKVSSVIVDQSLKDQVFSREAGRICYTIVQAEAKQTNG 72

  Fly   348 --FLEALLNTCRQWYQEREKLLFAIQGMKSPSRVRFTAFMAFLTEMFCQLKRRQLQLRTHHEGTP 410
              |...|||..:|.::.||:       .:..|...:...::|:..:|..||...:          
Zfish    73 SVFRRNLLNRLQQEFKAREE-------TRKRSTQEWVCLVSFICNIFDYLKVNNM---------- 120

  Fly   411 PPLVLLSLLSKCCGDCVR-PPIRSLSEIECLFYVLTCIGQDMEQQLPQQLELLMSLVRDAFLNAG 474
            |.:.|:..:..|.....: ..:::..|::||...|..||..:|:...|.::.|.:|:||.||...
Zfish   121 PMVALVHPVYDCLFRLAQSDALKNEEEVDCLVLQLHRIGDQLEKMNVQLMDELFNLLRDGFLLQE 185

  Fly   475 ESAASIRRTLLQLIELKASHWQLPGNTVLYY 505
            :.::..|..||:::|.:|..|:|......||
Zfish   186 DLSSMGRLLLLEILEFRAGGWKLSDTAQKYY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13124NP_001162923.1 MIF4G 280..494 CDD:280935 53/213 (25%)
mif4gdbNP_001013302.1 MIF4G 9..203 CDD:413423 52/211 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595003
Domainoid 1 1.000 65 1.000 Domainoid score I10034
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto41355
orthoMCL 1 0.900 - - OOG6_109434
Panther 1 1.100 - - O PTHR23254
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4098
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.