DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS2 and MRPS5

DIOPT Version :9

Sequence 1:NP_001260303.1 Gene:RpS2 / 34309 FlyBaseID:FBgn0004867 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_009810.3 Gene:MRPS5 / 852553 SGDID:S000000455 Length:307 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:50/167 - (29%)
Similarity:71/167 - (42%) Gaps:24/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGV-KCSKEVATAIRGA--IILAKLSV 145
            ::|..|:|  .|..||..|:...|.|.|.:||.||.:|||. |..:|::.||..|  ..:..|..
Yeast   145 TMKPLVMK--RVSNQTGKGKIASFYALVVVGDKNGMVGLGEGKSREEMSKAIFKAHWDAVRNLKE 207

  Fly   146 VP--VRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTS 208
            :|  ..|..:|:...:.|           .|.:.|..|..|.|:....|..::...|||:|....
Yeast   208 IPRYENRTIYGDIDFRYH-----------GVKLHLRSAKPGFGLRVNHVIFEICECAGIKDLSGK 261

  Fly   209 ARGSTGTLGNFAKATYAAIAKTYAYLTPDLWKEMPLG 245
            ...|...: |.||.|..|..|  |..|.|   |:.||
Yeast   262 VYKSRNDM-NIAKGTIEAFTK--AQKTLD---EVALG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS2NP_001260303.1 uS5_euk_arch 37..245 CDD:273398 48/165 (29%)
Ribosomal_S5 85..149 CDD:278748 24/68 (35%)
Ribosomal_S5_C 168..235 CDD:281681 18/66 (27%)
MRPS5NP_009810.3 Ribosomal_S5 144..209 CDD:395263 23/65 (35%)
Ribosomal_S5_C 223..285 CDD:397675 19/75 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.