DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS2 and AT1G64880

DIOPT Version :9

Sequence 1:NP_001260303.1 Gene:RpS2 / 34309 FlyBaseID:FBgn0004867 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_564842.1 Gene:AT1G64880 / 842796 AraportID:AT1G64880 Length:515 Species:Arabidopsis thaliana


Alignment Length:268 Identity:59/268 - (22%)
Similarity:98/268 - (36%) Gaps:71/268 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GKEDSKEWVPVTKLGRLVREG---------------KIKSLEEIYLYSLPI--KEFEI----IDF 79
            |.|:.:|        |||.:|               .:|..::|.|..|..  |:.||    :|.
plant   266 GGEEREE--------RLVADGPKDDNDDDDDEEEFDDMKERDDILLEKLNAIDKKLEIKLSELDH 322

  Fly    80 FLGSS---LKDE---------------------------VLKIMPVQKQTRAGQRTRFKAFVAIG 114
            ..|..   |::|                           |:.:..|.|.|:.|:..|:.|.:..|
plant   323 TFGKKGKRLEEEIRELAEDRNALTEKKRQPLYRKGYDVHVIDVKKVCKVTKGGRVERYTALMVCG 387

  Fly   115 DNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLI 179
            :..|.||.....::...:|::.|......::..|.|       .:.||:...:........:.|.
plant   388 NYEGIIGYAKAKAETGQSAMQKAYEKCFQNLHYVER-------HEEHTIAHAIQTSYKKTKLYLW 445

  Fly   180 PAPRGTGIVSAPVPKKLLTMAGIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYLTPDLWKEMPL 244
            |||..||:.:..|.|.:|.:||.::..:...||..:. |..||...|:   .|..||...:| ..
plant   446 PAPTTTGMKAGRVVKTILLLAGFKNIKSKVIGSRNSY-NTVKAVLKAL---NAVETPKDVQE-KF 505

  Fly   245 GSTPYQAY 252
            |.|..:.|
plant   506 GRTVVEKY 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS2NP_001260303.1 uS5_euk_arch 37..245 CDD:273398 55/258 (21%)
Ribosomal_S5 85..149 CDD:278748 15/90 (17%)
Ribosomal_S5_C 168..235 CDD:281681 18/66 (27%)
AT1G64880NP_564842.1 RpsE 362..511 CDD:223176 40/160 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.