DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS2 and EMB3113

DIOPT Version :9

Sequence 1:NP_001260303.1 Gene:RpS2 / 34309 FlyBaseID:FBgn0004867 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_180936.1 Gene:EMB3113 / 817947 AraportID:AT2G33800 Length:303 Species:Arabidopsis thaliana


Alignment Length:178 Identity:54/178 - (30%)
Similarity:91/178 - (51%) Gaps:22/178 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRG 136
            |:.:|.|.|     ::.|:::..|.|..:.|::.:|:|.|.:||..|::|:|...:|||..|::.
plant   139 KKDKIRDGF-----EERVVQVRRVTKVVKGGKQLKFRAIVVVGDKQGNVGVGCAKAKEVVAAVQK 198

  Fly   137 AIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAG 201
            :.|.|:.::|.|       .:.|..|.|.:..|..|:..|.|.||..|||:::....:.:|.|||
plant   199 SAIDARRNIVQV-------PMTKYSTFPHRSEGDYGAAKVMLRPASPGTGVIAGGAVRIVLEMAG 256

  Fly   202 IEDCYTSARGSTGTLGNFAKATYAA---------IAKTYAYLTPDLWK 240
            :|:......||...|.| |:||.||         :|:.......:|||
plant   257 VENALGKQLGSNNALNN-ARATLAAVQQMRQFRDVAQERGIPMEELWK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS2NP_001260303.1 uS5_euk_arch 37..245 CDD:273398 54/178 (30%)
Ribosomal_S5 85..149 CDD:278748 19/63 (30%)
Ribosomal_S5_C 168..235 CDD:281681 24/75 (32%)
EMB3113NP_180936.1 rpsE 139..303 CDD:234790 52/176 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100429
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.670

Return to query results.
Submit another query.