Sequence 1: | NP_001260303.1 | Gene: | RpS2 / 34309 | FlyBaseID: | FBgn0004867 | Length: | 267 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_114108.1 | Gene: | MRPS5 / 64969 | HGNCID: | 14498 | Length: | 430 | Species: | Homo sapiens |
Alignment Length: | 244 | Identity: | 47/244 - (19%) |
---|---|---|---|
Similarity: | 89/244 - (36%) | Gaps: | 48/244 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 GFGSRGGRGGRGRGRGRWARGRGKEDSKE-----W----VPVTKLGRLVREGKIKSLEEIYLYSL 69
Fly 70 PIKEFEIIDFFLGSSLKDE-------------------------------VLKIMPVQKQT-RAG 102
Fly 103 QRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKV 167
Fly 168 TGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSARGSTGTL 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RpS2 | NP_001260303.1 | uS5_euk_arch | 37..245 | CDD:273398 | 38/221 (17%) |
Ribosomal_S5 | 85..149 | CDD:278748 | 15/95 (16%) | ||
Ribosomal_S5_C | 168..235 | CDD:281681 | 10/49 (20%) | ||
MRPS5 | NP_114108.1 | RpsE | 221..373 | CDD:223176 | 27/130 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0098 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |