DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS2 and MRPS5

DIOPT Version :9

Sequence 1:NP_001260303.1 Gene:RpS2 / 34309 FlyBaseID:FBgn0004867 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_114108.1 Gene:MRPS5 / 64969 HGNCID:14498 Length:430 Species:Homo sapiens


Alignment Length:244 Identity:47/244 - (19%)
Similarity:89/244 - (36%) Gaps:48/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GFGSRGGRGGRGRGRGRWARGRGKEDSKE-----W----VPVTKLGRLVREGKIKSLEEIYLYSL 69
            |.|::.|||.|.:.:.|....||:...:.     |    ||:.|.|.:....:....|:..:.:.
Human   107 GAGAKKGRGKRTKKKKRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEAD 171

  Fly    70 PIKEFEIIDFFLGSSLKDE-------------------------------VLKIMPVQKQT-RAG 102
            .|::.|..|......:|.|                               :|::..|...| :.|
Human   172 MIQQREEWDRKKKMKVKRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEG 236

  Fly   103 QRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKV 167
            ::...:..||:|:..|..|..:..:.:...|.|.|...|...:..:.| |      :.||:...:
Human   237 RKKSIRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIER-Y------EDHTIFHDI 294

  Fly   168 TGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSARGSTGTL 216
            :.:.....:::...|:|.|:........:..:.||:|.|....||...|
Human   295 SLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSINML 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS2NP_001260303.1 uS5_euk_arch 37..245 CDD:273398 38/221 (17%)
Ribosomal_S5 85..149 CDD:278748 15/95 (16%)
Ribosomal_S5_C 168..235 CDD:281681 10/49 (20%)
MRPS5NP_114108.1 RpsE 221..373 CDD:223176 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.