DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS2 and mrps5

DIOPT Version :9

Sequence 1:NP_001260303.1 Gene:RpS2 / 34309 FlyBaseID:FBgn0004867 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001070064.1 Gene:mrps5 / 562703 ZFINID:ZDB-GENE-060929-264 Length:397 Species:Danio rerio


Alignment Length:285 Identity:64/285 - (22%)
Similarity:101/285 - (35%) Gaps:69/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADEAPARSGFRG-----GFGSRGGRG-------------GRGRGRGR----W------------- 31
            |||.     :||     |.|:|.|||             |:..|.||    |             
Zfish    62 ADEL-----WRGVSAETGAGARKGRGKRAKRKVKKDLNKGQSLGEGRAGYLWPGLNTPIFKDGSI 121

  Fly    32 --ARGRGKEDSKEWVPVTKLGR----LVREGKIK--------SLEEIYLYSL-PIKEFEIIDFFL 81
              ...||:.:.||.....:..|    ..|:.|||        |...:.|..| |....|..:.|.
Zfish   122 QKPMQRGEAEQKEMTAALERQRDEWEKRRKAKIKKERGWTGGSWGGVSLGPLDPGPNGETYEDFD 186

  Fly    82 GSSLK-DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSV 145
            ...:: ..|..:.|.:.:.|:     ..|.||:|:.||..|..:..:.:...|:|.|...|...:
Zfish   187 SRVIELKSVFTVTPKESRKRS-----ISALVAVGNGNGVAGFALGKAADRTAALRKAKNRAMNYL 246

  Fly   146 VPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSAR 210
            ..:.| |      ..:|:...:..|....::|:....:|.|:........|..:.||:|.|....
Zfish   247 YYIER-Y------NDYTIYHDIESKYKKTTLRMKKQNKGYGLRCHRAVITLCKLIGIKDMYAKVD 304

  Fly   211 GSTGTLGNFAKATYAAIAKTYAYLT 235
            ||...| |..:|.:..:|....:.|
Zfish   305 GSVNLL-NITRALFQGLASQETHQT 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS2NP_001260303.1 uS5_euk_arch 37..245 CDD:273398 46/213 (22%)
Ribosomal_S5 85..149 CDD:278748 14/64 (22%)
Ribosomal_S5_C 168..235 CDD:281681 15/66 (23%)
mrps5NP_001070064.1 rpsE_bact 184..339 CDD:130093 34/158 (22%)
Ribosomal_S5 185..250 CDD:278748 15/69 (22%)
Ribosomal_S5_C 262..332 CDD:281681 16/68 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.