DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS2 and rps2

DIOPT Version :9

Sequence 1:NP_001260303.1 Gene:RpS2 / 34309 FlyBaseID:FBgn0004867 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001007869.1 Gene:rps2 / 493255 XenbaseID:XB-GENE-1003616 Length:281 Species:Xenopus tropicalis


Alignment Length:269 Identity:222/269 - (82%)
Similarity:237/269 - (88%) Gaps:8/269 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADEAPA-RSGFRGGFGSRGGRG-----GRGRGRGRWARGRGKEDSKEWVPVTKLGRLVREGKIK 59
            |||:|.. |.|||||||| ||||     ||||||||.||| ||.|.|||||||||||||::.|||
 Frog     1 MADDAGGNRGGFRGGFGS-GGRGRGRGRGRGRGRGRGARG-GKADDKEWVPVTKLGRLVKDMKIK 63

  Fly    60 SLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGV 124
            |||||||:||||||.|||||||||||||||||||||||||||||||||||||||||.|||:||||
 Frog    64 SLEEIYLFSLPIKESEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGV 128

  Fly   125 KCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVS 189
            ||||||||||||||||||||:||||||||||||||||||||||||:||||.||||||||||||||
 Frog   129 KCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVS 193

  Fly   190 APVPKKLLTMAGIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYLTPDLWKEMPLGSTPYQAYSD 254
            ||||||||.||||:||||||||.|.|||||||||:.||:|||:|||||||||.....:|||.|:|
 Frog   194 APVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEYTD 258

  Fly   255 FLSKPTPRL 263
            .|:|...|:
 Frog   259 HLAKTHTRV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS2NP_001260303.1 uS5_euk_arch 37..245 CDD:273398 185/207 (89%)
Ribosomal_S5 85..149 CDD:278748 60/63 (95%)
Ribosomal_S5_C 168..235 CDD:281681 56/66 (85%)
rps2NP_001007869.1 PTZ00070 41..265 CDD:240255 192/223 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 132 1.000 Domainoid score I5089
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37714
Inparanoid 1 1.050 430 1.000 Inparanoid score I1689
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1197354at2759
OrthoFinder 1 1.000 - - FOG0001382
OrthoInspector 1 1.000 - - oto104072
Panther 1 1.100 - - LDO PTHR13718
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1244
SonicParanoid 1 1.000 - - X871
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.190

Return to query results.
Submit another query.