DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS2 and mRpS5

DIOPT Version :9

Sequence 1:NP_001260303.1 Gene:RpS2 / 34309 FlyBaseID:FBgn0004867 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001036652.1 Gene:mRpS5 / 3355089 FlyBaseID:FBgn0287187 Length:407 Species:Drosophila melanogaster


Alignment Length:283 Identity:57/283 - (20%)
Similarity:106/283 - (37%) Gaps:64/283 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DEAPARSGFRG--GFGSRGGRGGRGRGRG-RWARGRGKEDS-------KEW----VPVTKLGRLV 53
            ::.||...:||  ...:.|.:.|||:|.| :.|:...|..|       :.|    .|:.:...|:
  Fly    46 NKLPAEDIWRGVTAVSNAGKKRGRGKGSGKKVAKDLNKGQSIGFGKCGRIWPGLNSPLIRGNELI 110

  Fly    54 REGKIK--------------SLEEIYLYSL---------------------PIKEFEIIDFFLGS 83
            .:.|:.              |:....|..|                     |:.:.|.:.|.. .
  Fly   111 NQQKLNENLDRENGILKLRDSMGSFKLMKLNPIDRGWSGSKMPGRSIGPPDPVGDEEFVSFDT-R 174

  Fly    84 SLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPV 148
            .|:::::.||    :...|::.|:......|:.||..|.....:.||.||:|.:...|...::.:
  Fly   175 VLENKIVFIM----KGNMGRKRRYSVLSVTGNGNGLAGFATAKAPEVRTALRKSKNRAGQKLINI 235

  Fly   149 RRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSARGST 213
                   .:.:..|:........|...:.....|.|.|:|.....:.:..:.||:|.|....|||
  Fly   236 -------SLCENRTIFHDFRTDFGKTKIFCFQKPDGYGLVCHRAIQTICKVIGIKDLYAKIEGST 293

  Fly   214 GTLGNFAKATYAAI--AKTYAYL 234
             .:.|.|||.:..:  .::|.|:
  Fly   294 -NIQNIAKAFFIGLMTQRSYQYI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS2NP_001260303.1 uS5_euk_arch 37..245 CDD:273398 46/246 (19%)
Ribosomal_S5 85..149 CDD:278748 15/63 (24%)
Ribosomal_S5_C 168..235 CDD:281681 18/69 (26%)
mRpS5NP_001036652.1 Ribosomal_S5 171..235 CDD:278748 16/68 (24%)
rpsE_bact 178..323 CDD:130093 33/150 (22%)
Ribosomal_S5_C 251..318 CDD:281681 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0098
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13718
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.