DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS2 and Mrps5

DIOPT Version :9

Sequence 1:NP_001260303.1 Gene:RpS2 / 34309 FlyBaseID:FBgn0004867 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001099975.1 Gene:Mrps5 / 296134 RGDID:1308318 Length:432 Species:Rattus norvegicus


Alignment Length:283 Identity:57/283 - (20%)
Similarity:100/283 - (35%) Gaps:78/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FRGGFGSRGGRGGRGRGRGRWARGRGKEDSKE------------W----VPVTKLGRLVREGKIK 59
            ::|.....|  .|..:|||:..:.:.|:|..:            |    ||:.|.|.:...|: :
  Rat   101 WKGALAETG--AGARKGRGKRTKKKKKKDLNKGQIIGEGRSGFLWPGLNVPLIKSGVVQNIGQ-R 162

  Fly    60 SLEEIYLYSLPIKE----------------------------------------FEIIDFFLGSS 84
            |.||.......:.|                                        :|..|      
  Rat   163 SKEEQQKVEADMAEQREEWDRKRKIKVKRERGWSGNTWGGVSIGPPDPGPNGETYEDFD------ 221

  Fly    85 LKDEVLKIMPVQKQT-RAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPV 148
              ..:|::..|...| :.|::...:..||:|:.||..|..|..:.:.|.|.|.|...|...:..:
  Rat   222 --TRILEVRNVFNMTAKEGRKKSVRVLVAVGNGNGAAGFAVGKAADRADAFRKAKNRAIHYLHYI 284

  Fly   149 RRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSARGST 213
            .| |.|      ||:...::.:.....:|:...|||.|:........:..:.||:|.|....||.
  Rat   285 ER-YEG------HTIFHDISLRFKRTHIRMKKQPRGYGLRCHRAIITICRLIGIKDMYAKVNGSV 342

  Fly   214 GTLGNFAKATYAAIAK--TYAYL 234
            ..| |..:..:..:|:  |:.:|
  Rat   343 NML-NLTRGLFHGLARQETHQHL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS2NP_001260303.1 uS5_euk_arch 37..245 CDD:273398 51/257 (20%)
Ribosomal_S5 85..149 CDD:278748 16/64 (25%)
Ribosomal_S5_C 168..235 CDD:281681 16/69 (23%)
Mrps5NP_001099975.1 rpsE_bact 219..374 CDD:130093 38/162 (23%)
Ribosomal_S5 220..285 CDD:278748 17/72 (24%)
Ribosomal_S5_C 299..367 CDD:281681 16/67 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.