DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS2 and mrps5

DIOPT Version :9

Sequence 1:NP_001260303.1 Gene:RpS2 / 34309 FlyBaseID:FBgn0004867 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_593699.1 Gene:mrps5 / 2543504 PomBaseID:SPAC4G9.17c Length:387 Species:Schizosaccharomyces pombe


Alignment Length:213 Identity:48/213 - (22%)
Similarity:78/213 - (36%) Gaps:40/213 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GKEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDF-FLGSSLKD------------ 87
            |.|:|...:|          .|.:..::...:.:..| |...|| ..|.|..|            
pombe   166 GSEESNGEIP----------DKWEDFKDDLTFEISSK-FSPFDFGDAGKSTSDAEFLSDISGIPK 219

  Fly    88 ---EVLKIMP-----VQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLS 144
               ..|..:|     |..|||.|:.........:|:.||..|.|...::..:.|.:.:...|..:
pombe   220 SDLRALMFVPLVRRRVVNQTRKGKIASMYVLTVVGNRNGVAGFGEGKAESYSLAYKQSCGRAVKN 284

  Fly   145 VVPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSA 209
            :|.:.| |      ...||...:..|..:|.:.|...|.|.|:...|:..::...|||:|.....
pombe   285 MVYIPR-Y------DKRTVYGVIHKKFHAVRLTLRSRPAGFGLRCNPILHEICRCAGIKDISGEI 342

  Fly   210 RGSTGTLGNFAKATYAAI 227
            .||...: |..||.:.|:
pombe   343 LGSKNGM-NTVKAMFEAL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS2NP_001260303.1 uS5_euk_arch 37..245 CDD:273398 47/212 (22%)
Ribosomal_S5 85..149 CDD:278748 16/83 (19%)
Ribosomal_S5_C 168..235 CDD:281681 17/60 (28%)
mrps5NP_593699.1 RpsE 203..382 CDD:223176 38/165 (23%)
Ribosomal_S5 230..289 CDD:278748 13/58 (22%)
Ribosomal_S5_C 303..369 CDD:281681 17/58 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.