DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS2 and mrps-5

DIOPT Version :9

Sequence 1:NP_001260303.1 Gene:RpS2 / 34309 FlyBaseID:FBgn0004867 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_506145.2 Gene:mrps-5 / 179721 WormBaseID:WBGene00008452 Length:436 Species:Caenorhabditis elegans


Alignment Length:261 Identity:51/261 - (19%)
Similarity:84/261 - (32%) Gaps:72/261 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RGKEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIID---FFLGSSLKDEVLKIM--- 93
            :|:.::::  ||..|.|..|.|......|....:.||:..|..:   ..:....:||:...|   
 Worm    40 KGRRNTRQ--PVRPLNRFYRIGSSPMKIEFAGLNAPIRMRETENQNLMSIAEQTEDEIRDSMGGT 102

  Fly    94 -PVQKQTRAGQRTR-----------FKAFVAIGDNNG--------------HIGLGVKCSKEVAT 132
             .:.::...|::.|           |.....:|...|              ...|.||.:..:..
 Worm   103 KKILEERDTGKKKRNREKLHPMERGFSGTQLVGQKLGAPPPLDGVNFDDFETYCLEVKRTSNMTN 167

  Fly   133 AIRGAIILAKLSVVPVRRGYWGNKIGKP--HTVPCKVTGKCGSVSVRLIPA-------------- 181
            .......::.|.|....||..|..:||.  |.....:....|..|.:|...              
 Worm   168 VFGRVHTMSALVVTGNGRGLAGYAVGKAPIHRTTTAIINGMGMASRKLFHVELHEGRTIYQDFYA 232

  Fly   182 ------------PRGTGIVSAPVPKKLLTMAGIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYL 234
                        |||.|:...|...|:....||:|.|....|||   .|:       :|.|:|::
 Worm   233 ECRNTRVFAQRRPRGFGLTCHPRLIKICEAIGIKDIYVKVEGST---KNY-------LALTHAFV 287

  Fly   235 T 235
            |
 Worm   288 T 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS2NP_001260303.1 uS5_euk_arch 37..245 CDD:273398 50/259 (19%)
Ribosomal_S5 85..149 CDD:278748 13/92 (14%)
Ribosomal_S5_C 168..235 CDD:281681 20/92 (22%)
mrps-5NP_506145.2 rpsE_bact 151..309 CDD:130093 32/148 (22%)
Ribosomal_S5 152..219 CDD:278748 14/66 (21%)
Ribosomal_S5_C 232..302 CDD:281681 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.