DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS2 and AgaP_AGAP004091

DIOPT Version :9

Sequence 1:NP_001260303.1 Gene:RpS2 / 34309 FlyBaseID:FBgn0004867 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_312962.4 Gene:AgaP_AGAP004091 / 1274009 VectorBaseID:AGAP004091 Length:458 Species:Anopheles gambiae


Alignment Length:283 Identity:59/283 - (20%)
Similarity:100/283 - (35%) Gaps:76/283 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DEAPARSGFRG--GFGSRGGRGGRGRGRGRWAR---------GRGKEDSKEW----VPVTKLGRL 52
            ::.||...::|  ...:.|.:.|||:|.||...         |.||.:. .|    .||.:...|
Mosquito    74 NKLPADQIWKGVISVSNAGKKRGRGKGSGRITPKDLNKGQMIGYGKANI-VWPGLSAPVIRGREL 137

  Fly    53 VREGKIKSLEEIYLYSLPIKEFEIIDF--------------------------------FLGSSL 85
            |::.|:...:|.......|:: |:::|                                |:|...
Mosquito   138 VQQQKLPEDKEREAKLRRIRD-EMVNFKRLKLSPLERGWSGSKMPGRSIGPPDAVGEDEFIGFDT 201

  Fly    86 KDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRR 150
            |...||.: |..:...|::.|..|....|:.||..|.|...:.|...|:|.|             
Mosquito   202 KCLELKAV-VNMKGNHGRKRRVSAMAVTGNGNGLAGFGFGKAIEGRAALRQA------------- 252

  Fly   151 GYWGNKIGKP---------HTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCY 206
               .|:.|:.         |||......:.|:..:.:...|.|.|:......:.:..:.||:|..
Mosquito   253 ---KNRAGQKLMHFDLCNGHTVFHDFHCQFGATKLFVERKPEGYGLKCHRAIRTVCEVLGIKDLR 314

  Fly   207 TSARGSTGTLGNFAKATYAAIAK 229
            ....||| .:.:..||.:..:.|
Mosquito   315 AKCEGST-NVQHVVKAFFIGLLK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS2NP_001260303.1 uS5_euk_arch 37..245 CDD:273398 47/238 (20%)
Ribosomal_S5 85..149 CDD:278748 16/63 (25%)
Ribosomal_S5_C 168..235 CDD:281681 13/62 (21%)
AgaP_AGAP004091XP_312962.4 Ribosomal_S5 199..262 CDD:278748 18/79 (23%)
Ribosomal_S5_C 278..346 CDD:281681 13/60 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.